(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE127

ASHGO_3.PE127        Location/Qualifiers
FT   CDS_pept        complement(207337..212217)
FT                   /codon_start=1
FT                   /gene_family="HOG000141963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747802"
FT                   /locus_tag="AGOS_ACL079C"
FT                   /product="ACL079Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS51149.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG058331"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI0001DB2783"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CJ8"
FT                   /transl_table=1
FT                   /translation="MDFSIPAHLSAEAVGQLQELIQDYKDGNLTAKGYASKRAQVLERG
FT                   AGSPVRDGASMCSGAGVPTPQALASPLSCLSAGTGFHGREQSVSSTIRTSGQQDMQSTG
FT                   SFSLYRVTTSNSNTMAVRGYGDGRGAPRPERRTYQPLIPLLPRSAEGAPAHLDSLPSVL
FT                   RGRSQTYDRETAMVSISARGKENSITWEKLYLRAEKVAHELGKTKVYKMNKLLLWYDPG
FT                   EAIEFAVALLGCFIAGTIAVPVSFETYTLQEIVEIIKQTNAKSILISEECSKQLDTLYV
FT                   NSRSKLKLLKSNFFSQLTFIKTDDLGTYAKAKRSTPAFDIPNVAYIEFTRTPLGKLSGV
FT                   VMKHQVLTRQFENFTAILNSRSKKNWRKGDIRRPYTRGKERFMRYVILSSLDSTRSTGL
FT                   VLGTLFNIFSGNLLVCVHPHLLRRPGSYESIINKYRADILLSDQLQLKQVVINYLENPE
FT                   STISKKNKMDFSCIKWCIASCTTIDTEVSNMIVHKWLKNLGCLDASQAYSPILTLLDFG
FT                   GIFISLRDQLGNLENFPLHDYKLRLQDDVFIDKEQLKNNIVQPSISAMINSSSSIKDFL
FT                   RLTTFGYPIPDAMVCVVDPDTRMLVEDLTVGEIWISAPSVTDEFYHMDKLTDFVFNAKL
FT                   NFKKMLATLEETELHCSRELYASSIERLDTIFSLFPPDTTFLRTKLIGFIHNGKIYTLS
FT                   LIEDMFLQNKLVRLQNWSHTSDITRSIKDPPSADKEVAVKTDKALSSKRVVQTFYLQHV
FT                   SENLVRTVDKVSEVAAFELDHDKDEHFLVVVVESSLANTPVIGSAVSSAIPQINMADKR
FT                   TLERRMNDLTEQIYKILWIFHKIQPFCVMVVPPGSLQRRYCSLEIANRTVEKHFLNCSL
FT                   HSKFVKFQLDNVILDYVPHSSYYNESIFSEHLSKLRHRSLEDNYFNSMGMIPESALQTS
FT                   GLDYKEDTLDSRTSEKLGRFETIMAILEWRSQKHGNDFAFCNGNSFSTAGASIDQNKKF
FT                   SWNSFSSLVASYIKKIVESKSPLKHGDHVVVMADNSVDYTAIVIACFYCRLVVIPLHIM
FT                   HDSHSEKEVNYLLKVIEVYEVKRLFVDHKVENLLEQNTHISILLKSHKHELPKITVFTK
FT                   VKRKNSLAPSQFKTVLHEKFGRLSKTDPCVVWINHDDDASTDLNVLMSHSTLLKMSKVL
FT                   KETLRMTNENHIFSVTNYTRDIGFLQSCILGIYVGATTSLFSPSECMMNPRHLLIGLQN
FT                   MNIKDLVLCPDMLYMLMDRGCAMIEKQTQMVVSSGSIDKRRDTDAATVLYPNFLRNIQN
FT                   IMVPFTGRPRFQVMQTLLMKYKLAGSSALQINYLYQHRFNPFIALRSYLGIPPVDVYLD
FT                   PIALREGIIHEFDPSTASSSVLSSAIHLQDSGIVTACTEVTIVNPETLEQCYENELGEI
FT                   WCCSEANVFDYSICRLGNNTASASEANRTPVQKPMRDPFITQQFKAKIKNNSHTDLSYL
FT                   RTGDLGFIKNITRPDADGRPMELSILYVLGSINETVEILGLTHFVVDLESTVLRTHSSI
FT                   LNCMVVKTGGLLSCLIECNSKVKIPEYSNLTPLVVSMLLKEHGVALDLCCFVKPNSLNY
FT                   LVKDWQKNRMKILNDWLGKRLYIEAQYGVNVGENNSIYLLSDFEKVH"
     atggacttca gcatcccggc gcacttgagt gcggaggcgg tggggcagtt gcaggagctc        60
     atacaggatt acaaggacgg gaacttgacg gcaaagggct acgcgtccaa gcgggcgcag       120
     gtgttggagc gcggggcggg gtcgccggtg cgggacggcg cgagcatgtg cagcggggca       180
     ggggtgccga cgccgcaggc gcttgcgtcg ccgttgtcgt gcctctctgc ggggacgggg       240
     ttccacgggc gcgagcagtc ggtgtcgtcg acgatccgca cgagcgggca gcaggacatg       300
     cagtcgacag ggtcattctc gctctaccgg gtgacgacgt cgaactcgaa cacgatggcg       360
     gtgcgggggt acggggacgg gcggggggcg ccgcggccgg agcggcggac gtaccagcct       420
     ctgatcccgc ttttgccgcg gagcgcggag ggcgcgccgg cgcacttgga ctcgttgccg       480
     tcggtgttgc gggggcggtc gcagacgtac gaccgggaga cggcgatggt gagcatcagc       540
     gcgcggggca aggagaactc gatcacgtgg gagaagctct acctccgggc ggagaaggtg       600
     gcgcacgagc tcggcaagac gaaggtgtac aagatgaaca agctcttgct ctggtacgac       660
     ccgggcgagg cgattgagtt cgcggtggcg ctcttggggt gcttcatcgc cgggaccatc       720
     gcggtgccgg tgtcatttga gacgtacacc ttgcaggaga tcgtggagat catcaagcag       780
     acgaacgcga agtcgatcct catctccgag gagtgctcga agcagctcga cacgctctac       840
     gtgaacagcc gctcgaagtt gaagttgctc aagagcaact tcttctcgca gctcacgttc       900
     atcaagacgg atgatctcgg gacgtacgcc aaggccaagc gctcgacgcc ggcgttcgac       960
     atacccaacg tggcctacat agagttcacg aggacaccgc tggggaagct ttccggcgtt      1020
     gtgatgaagc accaggtgtt gacacgccag ttcgagaact tcactgctat tctcaattcc      1080
     cgctcgaaga aaaactggcg caagggcgac atacgaagac cgtacacgcg gggcaaggag      1140
     cgcttcatgc gctacgtgat tctgtccagc ttggactcca cgcgctccac cgggttggtg      1200
     ctcggcacgc tgttcaatat cttcagcggc aatctcttgg tctgtgtgca cccccatttg      1260
     ctaagacgcc cgggcagcta cgagtctatt atcaacaaat acagggccga cattctactc      1320
     agcgatcagt tgcagttgaa gcaggtcgtc atcaactatt tggaaaaccc agaatcgaca      1380
     atatcgaaga agaacaaaat ggactttagc tgcataaagt ggtgcattgc ctcgtgcacg      1440
     acaattgaca cagaggtgag caacatgatc gttcataaat ggttgaagaa tttggggtgt      1500
     ttagatgcgt cgcaggcgta ctcgccaatt ctcactcttc ttgactttgg tggcattttc      1560
     atttctttgc gggaccaact aggtaatctt gagaatttcc cgttgcatga ctacaaacta      1620
     agacttcagg acgatgtctt catagataaa gaacagttga agaataatat cgtgcagcca      1680
     agcatctccg cgatgattaa ctcatccagt tctatcaagg actttttacg cttaacgacc      1740
     ttcggatatc cgatcccaga tgcaatggtt tgtgtcgtcg atccggatac gcgcatgcta      1800
     gtcgaagact taacggtggg agaaatctgg atttcagcgc cgagtgtcac cgacgagttt      1860
     tatcatatgg ataaactaac tgactttgtt ttcaacgcca agttgaattt caaaaaaatg      1920
     ctagccacgc tagaagaaac agaacttcac tgtagtaggg aattatacgc atcgagcatt      1980
     gaacgtttgg atacaatatt ttcgcttttt cccccagata ctacattttt gaggacaaag      2040
     ttgattgggt tcatacacaa tggtaaaatc tacactttat ctctaattga agatatgttt      2100
     cttcaaaaca aactagtaag gctgcaaaat tggtcgcaca cttcggatat tactaggtcc      2160
     ataaaagatc caccttctgc tgataaagag gttgcggtca aaacggataa ggctctgagt      2220
     tccaagcgtg tcgtacaaac tttttatcta cagcacgtca gcgagaactt agtgcgcact      2280
     gttgataagg tctccgaggt tgcggccttt gaactagatc atgacaagga cgaacatttc      2340
     ctagtggtag tagttgaaag ttcattggcc aatactcctg ttattggaag cgcggtctcc      2400
     agtgctattc cgcagataaa tatggcagat aaaagaacgt tagagcggag gatgaatgat      2460
     cttactgaac agatttataa aattctatgg atatttcata aaatacagcc tttttgtgtt      2520
     atggtggttc cccctggctc actacagagg agatattgct ctttggagat agccaatagg      2580
     acggtggaaa agcactttct caactgcagt cttcactcta agtttgtcaa attccaattg      2640
     gataacgtga ttctggatta tgttccacat tcttcttact ataatgagag tatattctct      2700
     gagcatcttt caaagctacg gcataggtcc ctcgaggata attatttcaa tagtatgggt      2760
     atgattccgg aatctgctct tcagacatca ggtctcgatt ataaagaaga tactttggac      2820
     agccggactt ctgaaaaact aggcagattt gagacgataa tggctattct agagtggaga      2880
     tctcaaaagc atgggaacga ctttgccttt tgcaacggga acagtttctc gacagcaggt      2940
     gcatcgatcg accaaaataa aaagttttcg tggaactcgt ttagttcact cgttgcatcc      3000
     tacatcaaaa agattgtaga atcaaaaagt ccattgaaac atggagatca tgtcgtggtg      3060
     atggcagata attctgttga ttatactgct attgttatcg cctgttttta ttgtcggtta      3120
     gtcgtcattc cattgcacat aatgcatgac tctcatagtg aaaaagaggt caattatcta      3180
     ctgaaagtga tagaggtcta cgaagttaaa cgactcttcg ttgatcataa agttgaaaat      3240
     ttgttggaac aaaacacaca tattagcatc ctattgaaga gtcataagca cgagctgcct      3300
     aagatcactg tattcactaa agtgaaacgg aaaaattcac ttgcccctag ccagttcaaa      3360
     actgtgcttc atgaaaaatt cggtcgttta tctaaaacag atccttgtgt tgtttggatt      3420
     aatcacgatg atgacgcctc tacggaccta aatgtgttga tgtcacactc aaccttattg      3480
     aagatgagca aagtattgaa agaaacctta agaatgacta atgaaaatca catattctct      3540
     gtcactaatt ataccaggga tatagggttt ttgcaaagct gcattctcgg aatatacgtt      3600
     ggcgccacta ctagtctctt tagcccatct gaatgtatga tgaaccctag acatctccta      3660
     ataggtctac agaatatgaa tatcaaggac ttggttttat gtccggatat gctatacatg      3720
     cttatggatc gtgggtgcgc gatgattgaa aaacaaactc agatggtggt atcctctgga      3780
     tcaatcgata agcgtagaga tacagatgcc gcgaccgtgc tttatccaaa cttcttgagg      3840
     aacatccaga acattatggt tccatttaca ggacgtccaa gattccaagt aatgcaaacg      3900
     cttttgatga agtacaagtt agctggcagc tctgctctcc agatcaacta cttgtaccaa      3960
     caccgtttta atccctttat tgcattaaga tcctatctag ggattcctcc tgttgatgta      4020
     tacttggatc caattgccct tcgtgaaggt attattcatg aatttgatcc aagtacagct      4080
     agtagctctg ttctcagctc tgctatccat ttgcaggact ctggtatagt aactgcatgt      4140
     actgaggtta ctatcgtgaa tcctgagaca ttggaacaat gctatgaaaa cgaacttgga      4200
     gagatatggt gctgttctga agcgaacgtc ttcgactata gtatctgccg tctaggtaac      4260
     aacacggcct ctgctagcga agcaaaccgc acacctgtcc aaaagccaat gcgcgatcct      4320
     ttcattactc aacagttcaa agctaagata aagaataaca gccatactga tttatcatat      4380
     ctacgtacgg gggatctcgg gttcattaaa aatatcactc gcccagatgc tgatggcagg      4440
     cccatggagt tgtcaatact atatgtcttg gggagtataa atgaaacggt ggagatacta      4500
     ggcttgacgc acttcgtagt ggatctcgaa tctacagtac tgagaaccca ctccagtatt      4560
     ctcaactgca tggttgtgaa gacaggaggg cttctaagct gcctcattga gtgcaattca      4620
     aaagtaaaaa tcccggaata ctccaatcta acgccgttgg ttgttagtat gctcttgaaa      4680
     gagcacgggg tcgctttgga cttatgttgc ttcgtaaagc ccaactccct caactatctg      4740
     gtgaaggact ggcagaaaaa taggatgaaa atcctaaatg actggttggg gaagcggttg      4800
     tacatcgagg cacagtatgg cgtgaacgtc ggcgagaata actccatcta cctcctgtcg      4860
     gattttgaga aagtacattg a                                                4881
//

If you have problems or comments...

PBIL Back to PBIL home page