(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE130

ASHGO_3.PE130        Location/Qualifiers
FT   CDS_pept        join(214736..214879,215024..215452)
FT                   /codon_start=1
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747805"
FT                   /locus_tag="ACL076W"
FT                   /orf_name="AGOS_ACL076W"
FT                   /product="ACL076Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /biological_process="translation"
FT                   /cellular_component="90S preribosome"
FT                   /cellular_component="cytosolic small ribosomal subunit "
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS51152.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0022627"
FT                   /db_xref="GO:0030686"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="HOGENOM:HBG320156"
FT                   /db_xref="HOGENOM:HBG329875"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniParc:UPI0000252782"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CJ5"
FT                   /transl_table=1
FT                   /translation="MSAPQAKILSQAPTELELQVAQAFIDLENSSPELKADLRPLQFKS
FT                   IREIDVAGGKKALAIFVPVPSLAGYHKVQTKLTRELEKKFQDRHVIFLAERRILPKPSR
FT                   RSRQTQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQVD
FT                   YKLESFQAVYNKLTGKQIVFEIPSETH"
     atgtctgctc cacaagctaa gatcttgtcc caagcaccaa ctgaattgga attgcaggtc        60
     gctcaggcct tcatcgactt ggagaactcc tccccagagt tgaaggctga cttgagacca       120
     ttgcagttca agtccatcag agagattgac gtcgctggtg gcaagaaggc cttggccatt       180
     ttcgtgccag tcccatcttt ggccggctac cacaaggtcc agaccaagtt gaccagagag       240
     ttggagaaga agttccagga ccgccatgtt atcttcttgg ccgagagaag aattttgcca       300
     aagccatcca gaagatccag acagacccaa aagagaccaa gatccagaac tttgactgct       360
     gttcacgaca agatcttgga ggacttggtg ttcccaaccg agatcgttgg caagagagtc       420
     agatatttgg tcggtggtaa caagatccag aaggtcttgt tggactccaa ggacgtccag       480
     caagtcgact acaagttgga gtctttccag gctgtctaca acaagttgac cggtaagcaa       540
     atcgtgttcg aaatcccatc cgaaactcac taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page