(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE134

ASHGO_3.PE134        Location/Qualifiers
FT   CDS_pept        222769..224418
FT                   /codon_start=1
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774443"
FT                   /locus_tag="AGOS_ACL073W"
FT                   /product="ACL073Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51155.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniParc:UPI0001DB2786"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CJ2"
FT                   /transl_table=1
FT                   /translation="MATDIKAPLLVHTEDLEGSGTSSDSARSYYGGVKIAEDVISPVLA
FT                   NEVPQGRHLGLFSTVVMFVSRIVGSGIFATPSTMFVNCGGNALLFVTVWIVAMLAAFSG
FT                   LYLYLEFGCLLPRSGGPKNFLEAVYDRPRMMMSVAFASFSVLTGFTVSGAIVFGKYTLY
FT                   ALGFDRKYVNEDSAMCNYIGAAAVMLIVVIHGSSVKHGIIVQNILGGMKFLLIAVMSVT
FT                   GIYAVFFFDTRADDQNPAYYVKSHFWESRDSSLITASSLTASFMQAFFCFSGWDGVHSV
FT                   VSEVKDPVRTMRIAGPFSLLIAFGCYMLLNFAYLFVLSWEEIQGAGPLIGSILFSKLYG
FT                   PTLGGKFVTLCVAVSTASNLFVVIYGTSRMNQEFFREGYLPFSKQMASNWPWGSPLPSL
FT                   LCCGLITVAWLCFLPPSGAAYDYLVNFEGYSKQFFLMLIAIGLFIYRHRHPDIVAEIRA
FT                   SMIGVAFLAVISVYLMVGPFFGDQSGNVVGWLPPYQITTLLMFLVCFLYWLLKFVLLPR
FT                   LLGYRLQALIVTLSDGLEIKRWRRRYSKQASI"
     atggctaccg acattaaggc gccgctgctg gtacacacgg aggatctaga gggtagtggt        60
     acatcttcgg actccgccag atcctactat ggcggtgtga aaatcgcgga ggatgtcatt       120
     tcgccagtgc ttgccaacga ggtcccgcaa ggtcgacatt tgggcttatt ttctactgta       180
     gtcatgttcg tttcgcggat tgtagggtcg ggcatattcg ccacgcccag caccatgttc       240
     gtgaactgtg gcggcaatgc actgttgttt gtgacagtgt ggatagtcgc gatgctagcg       300
     gcgttttccg ggttatattt gtacttagag ttcgggtgcc ttttgccacg atcaggagga       360
     ccgaagaact tcctagaggc tgtctatgac cgccctagga tgatgatgag cgtggcgttt       420
     gcatccttta gcgttctaac tggctttaca gtatctggcg caattgtgtt tgggaaatat       480
     acgctctacg cgctgggatt cgaccggaaa tatgtcaacg aggactctgc aatgtgcaac       540
     tatattggtg cagctgcggt gatgctcatt gtggtgatcc acggctcttc agtcaagcat       600
     gggatcattg tacaaaatat tctaggaggt atgaagttcc tgttgattgc agtcatgtct       660
     gttacgggga tctacgcagt gtttttcttc gacacgcgtg ctgatgacca aaaccctgcc       720
     tattacgtga agtcgcactt ttgggaatct cgcgacagtt ctctaatcac tgcctcgtcg       780
     cttacagctt cattcatgca ggcgtttttt tgtttctccg gctgggacgg agtgcactct       840
     gttgtatcag aggttaaaga ccctgtccgc accatgagaa ttgcaggtcc attttcattg       900
     ttaattgcat ttggctgtta catgcttttg aactttgcgt acttatttgt tttatcttgg       960
     gaggagattc agggagctgg cccgctcata ggctcgatac ttttctccaa actatatggt      1020
     cctacgctcg gcggtaaatt tgtgacgcta tgtgtggcgg tatctactgc ttccaatcta      1080
     ttcgtcgtca tatatggcac ctctcggatg aaccaggagt ttttcaggga aggatattta      1140
     cccttcagta agcagatggc cagtaactgg ccatggggtt ctcctctacc atcgctgttg      1200
     tgttgcgggt taattactgt cgcgtggcta tgctttctac ccccaagcgg cgcagcatat      1260
     gactatttgg ttaactttga gggttattcg aaacagttct tcttaatgtt gattgcaatc      1320
     ggacttttta tatacaggca cagacatcca gatattgtcg cagagattag ggcgtctatg      1380
     atcggcgtgg catttttagc ggtaatatcg gtatacttaa tggttggccc tttctttggt      1440
     gaccaatcag gaaacgttgt aggttggcta ccaccatatc aaatcaccac gcttttaatg      1500
     ttcctcgtat gtttccttta ttggctacta aagttcgttc tcctaccgcg actattaggc      1560
     tataggctac aggctttgat agtaacctta tctgatggcc tagagattaa aaggtggaga      1620
     agacgatatt ctaaacaggc ctctatataa                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page