(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE142

ASHGO_3.PE142        Location/Qualifiers
FT   CDS_pept        complement(238400..239185)
FT                   /codon_start=1
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747812"
FT                   /gene_name="SDH2"
FT                   /locus_tag="ACL065C"
FT                   /product="Succinate dehydrogenase [ubiquinone] iron-sulfur
FT                   subunit, mitochondrial"
FT                   /EC_number="1.3.5.1"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="3 iron, 4 sulfur cluster binding"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /function="succinate dehydrogenase (ubiquinone) activity "
FT                   /biological_process="electron transport chain"
FT                   /biological_process="transport"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51163.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008177"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0051538"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG299101"
FT                   /db_xref="HOGENOM:HBG616382"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniParc:UPI000025278D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CI4"
FT                   /transl_table=1
FT                   /translation="MVFRAGIGRIGLIRGLATQAAEVSATRYKSFKIYRWNPDTPAEKP
FT                   RMQEYKVDLNKCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLC
FT                   KIDQAENKDVKIYPLPHMYVVKDLVPDLTNFYKQYKSIQPYLQKASKPADGREHLQSIA
FT                   DRKKLDGLYECILCACCSTACPSYWWNNEQYLGPAVLMQAYRWMVDSRDGAGAGRREQL
FT                   QNAMSVYRCHTIMNCTRTCPKGLNPGKAIAEIKKALAFA"
     atggttttta gagcaggcat tggtcgtatc ggtctcatca gagggctcgc cacacaagcg        60
     gcggaagtat cggcgacgag gtacaagagc ttcaagatct accgctggaa cccggacact       120
     ccagccgaga agccgcggat gcaggagtac aaggtggacc tgaacaagtg tgggccgatg       180
     gtgctagacg cgctgatcaa gatcaagaac gagcaggatc ccacgctgac gttccggcgg       240
     tcttgccgtg agggcatctg cgggtcgtgc gcgatgaata tcggcggccg caacacgctg       300
     gcctgcttgt gcaagatcga ccaggccgag aacaaagacg tgaagatcta cccactgcct       360
     cacatgtacg tggtgaagga tctcgtgccg gacctcacca acttctacaa acagtacaag       420
     tcgatccagc catacctgca gaaggcttcc aagcccgccg acgggcgcga acatctgcag       480
     agcattgccg accgcaagaa gctagacggc ctgtacgagt gtattctatg tgcatgctgc       540
     tcgacggcgt gcccatcgta ctggtggaac aacgagcagt acctcggccc agccgtcttg       600
     atgcaagcgt accgctggat ggtggactcc cgtgatggcg cgggcgcggg cagacgcgag       660
     cagttgcaga acgccatgtc cgtctaccgc tgccacacta tcatgaactg tacccggacg       720
     tgtccaaagg gtttgaaccc gggcaaggcc atcgccgaga tcaagaaggc cctagctttt       780
     gcctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page