(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE148

ASHGO_3.PE148        Location/Qualifiers
FT   CDS_pept        complement(259734..261095)
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747815"
FT                   /locus_tag="ACL059C"
FT                   /orf_name="AGOS_ACL059C"
FT                   /product="ACL059Cp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS51169.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0000252793"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CH8"
FT                   /transl_table=1
FT                   /translation="MRGGSQESRLVCVGEHGDQHGASVPALYQSTTFKQRTLDGQAYDY
FT                   TRSGNPTRTVAEGQVGRLYGVGPEQVMAVASGMTALDVVLRAVLRRGGRGTVIAGDDLY
FT                   GGTQRLLGLLAETGQARVVHVDTADTAAFCAAVAAAGEVACVLLESPTNPLMKVADVPA
FT                   LVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYLNGHHDIMAGVIVAAT
FT                   RALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAMVLAHWLREVCGFRA
FT                   VGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSERIVCSKKLQFWGVT
FT                   VSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVEDVEDLQQDLLAALEDA
FT                   GAVVVRDGGRTIVNRLNGHIGTHVSSSEQRCIYRDFFGDSSNPSLEVGSLVAKL"
     atgcggggcg gttctcagga gagcaggcta gtgtgcgtgg gcgagcacgg ggaccagcac        60
     ggagcgagcg tgccggcgct gtaccagagc acgacgttca agcagcggac gctggacggg       120
     caggcgtacg actacacgcg gtccgggaat ccgacgcgga cggtggcgga gggccaggtg       180
     gggcggcttt acggggtggg gccggagcag gtgatggcgg tggcgagcgg gatgacggcg       240
     ctggacgtgg tgctgcgagc ggtgctgcgg cggggcgggc ggggaacggt gattgccggg       300
     gacgacctgt acggggggac gcagcggctg ctggggctgc tggcggagac ggggcaggcg       360
     cgagtggtgc acgtggacac ggcggacacg gcggcgttct gcgcggcggt ggcggcggcg       420
     ggagaggtgg cgtgcgtgct gctggagtcg ccgacgaacc cgctgatgaa ggtggcggac       480
     gtgccggcac tggtggcgca cgtgaaggcg cacgcgcccg ggtgccgcgt ggttgtggac       540
     aacacgatga tgagcgggct gaactgcaac ccgctgcggc tgggcgcgga ctacgtgtac       600
     gagtctgcga ccaaatacct gaacgggcac cacgacatca tggcgggcgt gattgtggcg       660
     gccacacggg cgctggcgga ggaggcgtac ttcgtggtga actcggtcgg cgcgggcctg       720
     gcaccgatgg acgcgtggct gctgatccgc gggctcaaga cgctgagcct gcgcctgtac       780
     aagcagcagc acaacgcaat ggtgcttgcc cactggctgc gcgaggtgtg cggcttccgc       840
     gcggtgggcg gcaaccacgc gctgcagacg cgatttgtcg ggctgcgctc gcacccgcag       900
     cacaaactgc accgcagctt caaccgcggg ccgggcgctg tcttgtcgat ccagacgggg       960
     gacactgcgc tatccgaacg catagtgtgc tcgaagaagc tccagttctg gggcgtcacc      1020
     gtgtccttcg gctgtgtcaa ctctctgatc tcaatgccct gccgcatgtc gcatgcgtcc      1080
     atagacccgg agctgcggaa ggcccggcag ttccccgagg acctgatacg actgtcatgc      1140
     ggcgtggagg acgtggagga cctgcagcag gacctgctgg ccgccctaga ggacgctggc      1200
     gcggtggtag tgcgtgacgg tgggcgcacc atcgtgaaca ggctcaatgg ccacataggc      1260
     actcatgtgt cttcctcaga gcaacgctgc atctatcgtg acttcttcgg cgacagctcg      1320
     aaccctagcc tagaggtggg gagcctcgtt gccaaactgt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page