(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE15

ASHGO_3.PE15         Location/Qualifiers
FT   CDS_pept        complement(26476..27573)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626158"
FT                   /locus_tag="ACL191C"
FT                   /orf_name="AGOS_ACL191C"
FT                   /product="ACL191Cp"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51037.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1A9U"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025270F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV7"
FT                   /transl_table=1
FT                   /translation="MPRTITFDIPSHYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQ
FT                   PFTRPMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQRI
FT                   ISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSR
FT                   CLASSDRSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPL
FT                   FPGRDYHHQLWIILEILGTPSFEDFEQIKSKRAKAYIANLPMRPKIPWNVALSTNDINP
FT                   LAMDLLDKMLTFNPDKRISAADALKHPYLETYHDAEDEPDYELLNLQDNFWKVDNEARQ
FT                   KTEEEELSMDTLKAMLYEEVMKPLQ"
     atgccaagga cgatcacgtt cgacattcca tcgcactaca agctggtgga cctgattggc        60
     gagggcgctt atgggatcgt atgctctgcc atccacaagc cgacggggac gaaggtcgcc       120
     attaagaaga tccagccgtt cacgaggccc atgttcgtaa cgcggacact gcgggagctg       180
     aagctgctga agttcttcca cagccatgag aacattatct cggtgctgga catcgtgcgg       240
     cccacgtcgt accaggactt cgaggcggta tacctggtgc aggagctgat ggagacggac       300
     ctgcagcgga ttatctcaca gccgaacagc ttcctgtcgg acgaccacat acagtacttt       360
     acgtaccaga tccttcgcgc attgaagtcg cttcactctg cccaggtgat acatcgcgac       420
     ctgaagccgt cgaacctgct gctgaattcc agctgtgacc tgaagctgtg tgattttggg       480
     ctctcgcgct gccttgcctc gagtgaccgc tcgcgcgaga acatggtggg cttcatgacc       540
     gagtatgtgg cgacgcgttg gtaccgtgcg cccgaaatca tgctttcgtt ccaggagtac       600
     acgaccgcga tggacatctg gtcctgtggc tgcattcttg cggagatgat cagcgggaag       660
     ccgctgttcc cggggcgcga ctaccatcac cagctgtgga ttatcctgga gatcctcggc       720
     accccttcct tcgaggactt tgagcagatc aagagcaagc gagcaaaggc ctacatcgcg       780
     aatctgccca tgcggccgaa gatcccctgg aacgtggcgc tcagcacaaa cgacatcaac       840
     cccctcgcca tggacctcct ggataaaatg ctcacattca accctgacaa gcgcatcagt       900
     gccgcggacg cattgaagca tccttacctt gagacctacc acgacgcgga ggacgagccc       960
     gactacgagc tgcttaacct ccaggataac ttctggaagg tcgataacga agcccgccag      1020
     aagacagaag aggaggagct gtccatggat acactcaagg cgatgcttta cgaggaggtt      1080
     atgaaaccgt tgcagtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page