(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE153

ASHGO_3.PE153        Location/Qualifiers
FT   CDS_pept        269705..272623
FT                   /codon_start=1
FT                   /gene_family="HOG000246715" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747819"
FT                   /gene_name="ATG1"
FT                   /locus_tag="ACL054W"
FT                   /product="Serine/threonine-protein kinase ATG1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51174.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058343"
FT                   /db_xref="HOGENOM:HBG324852"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020656"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="UniParc:UPI0000252798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CH3"
FT                   /transl_table=1
FT                   /translation="MNNVKSGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNV
FT                   AIKAVSRSKLRNKKLLENLEIEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDL
FT                   TFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLV
FT                   HRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAETLC
FT                   GSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQ
FT                   FPKHAALESAMVDLICGLLTFEPAKRMGFTEFFSNGLVNEDLSPYEVESEPDLETKSKN
FT                   VAESNMFISEYLPTAERNKRASPIRLGDSCTLRGPCESPQGADPYPQDNTQSDQHEHLH
FT                   ADYSFQVEMGQDGQQADGEEKRKLYNNQEERSNEERQFGQVSNGRNQEDQLLLHQGRGQ
FT                   IPCEQNRQALQSHSHVAAKQIPDKDSKSSVSCQKHAASAPTKNDHRTTRLKEKTKCSYS
FT                   DLLLEKEYVVVEKKSVEVNALADEFAQAGSGAPAIRLPDQHHNDASQALQMARHSSTSV
FT                   SAANTAKQTLLRRNSRTLSSSGASTSRRPSLVDRRLSITSLGATNALSKALGMASLRLF
FT                   GNSHQQSSNGSSTFKQNPNVTSLLSPQTFQDMTENAVLSADHQWDNSRQADVLHDDSIM
FT                   KALENLTAKVYAIYSFAEVKFSQIIPLPPSSTQDPYTHKRMSNGSCAIDDEEDDIEHSP
FT                   GAETYRKNSSGANANTGNYNFSLDTIHEMNLNDLPPNDLYILCTEAIVLYMKSLSLLAY
FT                   AMHLTSKWWHESADKICPLKLNLLVQWIRERFNECLEKAEFLRMKTQSIQLHNGNQLSA
FT                   STMVSEPVFVEKLIYDRALDISKTAAKMEMQGEYLEGCEVAYSTSLWMLEALLDDVSDE
FT                   DNYNDDNLGHTGVLDKSDKEVIKRYIDSIANRLKALRRKLSR"
     atgaacaacg ttaaatcagg tggacgtcca gtggcaatag ttgcagagcg gtatgtggtt        60
     gagaaggaaa tcggccgcgg ctcgttcgca gtggtctaca agggacatct agccgacagc       120
     tcggcaggga atgtggcgat caaggcggtg tcgcgatcaa aactccgaaa caagaagctg       180
     ttggagaacc tggagatcga aatcgccatt ctaaaaaaga tcaagcaccc gcatatcgtg       240
     ggtttacttg aatgcgagcg cacgggcacg gacttttatc taatgatgga atactgtgcg       300
     ctgggtgacc tcacgttctt tattaagaag cgccgtagcc tgatggacaa gcaccctttg       360
     gttcggactt tatttgaaaa atacccacca cctagcgagc accacaatgg cttaaatcgg       420
     gtgttagtgg tgaactatct acagcagtta tcgtctgcgt tgaagttttt gcggtccaag       480
     aacttggtgc atagagatat caagccccaa aaccttttgc tgtcgacccc acttgtggat       540
     tacaatgacc ccgccgaatt tcacgctcgg gggtttgtgg ggatctataa tctacctata       600
     ctaaagattg ctgatttcgg tttcgctcgt tttcttccca acacatccct tgcagaaaca       660
     ttatgtggct ctcctctata catggcgccc gaaatactaa attaccagaa gtataatgca       720
     aaggctgact tatggtccgt tggcacggtg ctatacgaga tgtgctgcgg aaagcctcca       780
     ttcaaggcat ctaaccacct agagctattt caaaagatta agaaagctaa tgatgttata       840
     cagtttccta aacacgctgc attggagtca gccatggttg atttgatttg tggtttgctg       900
     acgtttgaac ccgctaaacg catgggattt acggagtttt tttcaaatgg actagtcaat       960
     gaagatctct ccccgtatga ggtagagtcc gagcctgact tagaaaccaa atctaagaac      1020
     gtggccgaga gtaacatgtt tatttcggaa tacctaccta ctgcagaacg aaataagcgg      1080
     gcatctccta tccgcttagg tgattcctgt actttgcggg gtccctgtga atcaccacaa      1140
     ggggccgatc cttaccccca ggataacacg cagtctgatc agcacgagca tttacacgca      1200
     gactattctt tccaggtaga aatgggccaa gatggacagc aagcggatgg agaagagaaa      1260
     agaaaacttt ataataacca ggaagagaga agcaatgaag aacgacagtt tggtcaggta      1320
     tctaacggcc ggaaccagga agaccagtta cttctacatc aaggacgggg acagataccg      1380
     tgcgagcaga atagacaagc cttacagtcg cactcccacg tcgcagctaa gcaaataccc      1440
     gataaagact cgaaatcctc agtatcatgt cagaagcatg cagcctcggc accaactaaa      1500
     aacgatcacc gtacgacaag gttaaaagag aagacaaaat gttcttattc cgacttatta      1560
     ctggagaaag aatacgttgt cgtagagaaa aaaagtgtcg aggtaaacgc cctagcagac      1620
     gaatttgccc aagcgggctc gggcgctcca gcaattaggc tgcccgatca gcatcacaat      1680
     gacgcctctc aagccctgca aatggctcgg cattcttcaa cttcagtttc tgccgcaaat      1740
     accgctaaac agacgttatt gcgccgtaat tcgaggactt tatcgtcaag tggtgcttct      1800
     acatcacggc gcccgtcatt agttgatcgt agattatcaa taacatcatt aggtgctaca      1860
     aatgcattat ccaaggcctt gggtatggcc tctttaagac ttttcggaaa cagtcatcaa      1920
     cagtccagta atggctcgtc aacgttcaaa cagaatccca atgttacctc tttactgagt      1980
     ccgcaaacat tccaggatat gacggaaaac gccgttctta gcgctgatca ccagtgggat      2040
     aattctaggc aggcagatgt tctccatgat gattcaataa tgaaggcgct ggagaactta      2100
     accgctaaag tttatgccat ttattctttt gctgaggtta aattttccca gattattccg      2160
     cttcccccaa gttccactca agacccctac actcacaaac ggatgagcaa tgggagctgt      2220
     gccatcgatg atgaggaaga tgatattgaa cacagcccag gagctgaaac ttatcgaaag      2280
     aattcctctg gagctaatgc caatactgga aattacaatt tctccttaga tactatacat      2340
     gaaatgaacc tgaatgacct accaccaaac gatctataca ttttgtgcac cgaagcaatt      2400
     gtactctata tgaagagtct ctctctattg gcctacgcta tgcatttaac ttcgaaatgg      2460
     tggcatgaat cagccgataa gatctgtcct ctcaagttaa atcttttagt gcaatggatt      2520
     agggagagat ttaatgagtg cttggagaaa gctgaatttt tgcgtatgaa gacccaatcg      2580
     attcagttac acaatggtaa tcagctttca gctagtacca tggtttcaga gccagtattt      2640
     gtggaaaagt tgatctatga tcgggcttta gacatatcta agacggctgc aaagatggaa      2700
     atgcagggtg agtatttaga aggatgcgaa gttgcatatt ctacatccct gtggatgctt      2760
     gaagcattac tcgacgatgt tagtgatgaa gataactaca atgatgataa tttaggtcac      2820
     actggcgttt tggacaagtc ggataaagaa gtgattaaga gatacattga cagcatagct      2880
     aaccggttaa aagcgttaag gcgaaaactt agtcgctag                             2919
//

If you have problems or comments...

PBIL Back to PBIL home page