(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE154

ASHGO_3.PE154        Location/Qualifiers
FT   CDS_pept        complement(273165..276710)
FT                   /codon_start=1
FT                   /gene_family="HOG000115426" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078722"
FT                   /locus_tag="AGOS_ACL053C"
FT                   /product="ACL053Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51175.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058344"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001DB27A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CH2"
FT                   /transl_table=1
FT                   /translation="MNNNQEPTESEGVAAAGGPNLEISRGEHGEPTCMPGKVEGYEADE
FT                   LSSSDSLNLLLERQRERQLNHPLHQNHIKAAHVQPGGRKVKETHKISLEYDPISKRKVL
FT                   NTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSWKLKKTPVREESEKIR
FT                   REIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCPGDQLEAAARGPPLL
FT                   TFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKISDFGVSLASSNSGTP
FT                   SSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLNIDRQSNPCSG
FT                   SLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEFMQSNGVSMI
FT                   SCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAHPFVCWDFDHVDGLSGQRISMRQAEKQ
FT                   KFLRHQDEEYKQISVSHDEVDNAVNGIGKGLKKSQIDTLFDSGVVKNKPLLNPTSVIDA
FT                   CALLKKPKTKDLKDRHSPTVFDSIRRETFSPTDIDSLNFILSEGSIANSKDFLPGQPST
FT                   PSPLHQPPIQAELSARELFQRELQKFDNDRDPNSIVSLPVNSSFASLDSFYIDNYAVND
FT                   TNVEAEFTPSFPTNDQRISSSYQQFTSSNLPHKGASALLSPFSNMNVSGTPKAQDKILA
FT                   SPPPLSINTLQLDSKRNGRIPRVSSILSPQSTTTRSSSSAELSPAAFASRFRMTPTAAI
FT                   ASSESAIRLDNRSQKSELATPRLSIGTNGTSQTILAKRYDSSRSLASQVTKSTPLKQGN
FT                   PPLTKKIIFQELHGSDEEKDSITTDSAAYMSTESAGEYSYDGTKSDTESLPFEFGIDSE
FT                   HGSEISLRNVPAVGGIDSFCQPETLSASSASTASDADDDELVFPPRHVGRSRRFSSSAD
FT                   NSSSRALGVSQPAISEEATDIAPASISGQLKASDSLSTLTQINSARTVNTPSGDGVNSV
FT                   RLNTDPSYVLPVSQDVEDSIDVPAEVLHMIPELHKQDRGNMDPVTQTGGVLTNSWLLPH
FT                   TAAQATTQEAHVDQVLITSSQDHSHHLSSRDLLQSVLSSSDTSRRSSLHGGTSVHSPTS
FT                   TSAAQDESRLINAAKKLARIRKTDDSSGLTMSFRRQSLAPEFRHKEAHSKSRSCSISLG
FT                   QLDKRNNDTLGSPYN"
     atgaacaata accaagagcc tacagaatct gaaggcgttg ctgcggccgg cggtccgaac        60
     ctagagatca gccggggcga acatggcgaa ccaacatgca tgccgggcaa agtggagggg       120
     tacgaggcag acgagctctc atcgagcgat tcgctcaatt tgctgttgga gcgccagcgc       180
     gaacggcagt tgaatcatcc actgcaccag aaccacatca aggctgctca tgtacagcct       240
     ggggggcgga aggtaaaaga gacacacaaa atatcgcttg agtacgaccc aatttcgaaa       300
     cggaaggtgc ttaataccta cgagataatc cgggagcttg ggagcggcca acacgggaaa       360
     gtaaaactag cgcttgacct cgtgacgaaa caacatgtcg caatcaagat cgtggacaga       420
     cacggcaaga agaagagttc atggaagctc aagaagacgc ctgtacgtga ggagagtgaa       480
     aagataagaa gggaaatagc gataatgaag aagtgtgacc acgagcatgt tgtgaagttg       540
     atcgaggttc tcgacgacat gaagtcacgg aaaatatact tggtgctaga gtactgttcc       600
     aaaggtgaag taaagtggtg tcccggcgac cagttggaag ctgctgcgcg cgggccacct       660
     ttgcttacgt ttcagcgaac gcgggagatt ctacgtggtg ttgtacttgg tttggaatat       720
     ttgcattatc aggggatcat tcatcgtgat attaagccag ccaacttgct tctttcagag       780
     catgacatcg tgaaaatttc tgactttggt gtgtccttag cttcatcgaa ctcaggtaca       840
     ccctcgtcac gctcctcttc ctcctcttca gttaaaggtg tcttgggggc tgaaggtccc       900
     gatgacttgg aattggcgaa aaccgcgggt actccagctt tctttgctcc ggagatatgt       960
     ttaggcagtg atgcatatga aaaattaaac attgatagac aaagcaaccc atgttctggg      1020
     tccttaattt catatatgat agatatatgg gcgttaggtg ttacgttata ctgtttgtta      1080
     tttggaaagt tgccattcat tgcggaatat gagatggagt tattcgaaaa gatagttaac      1140
     gatccactag agtttccaag gctagaattc atgcaatcca acggcgtgtc gatgatctcg      1200
     tgcaaagaag aatatctatc ggcacaggat ttgttaaaca aactcttaga aaagaatcca      1260
     atgcagcgaa taaatattgt tgacattaag gcacatccgt ttgtatgttg ggattttgat      1320
     catgtagatg ggctaagtgg acagagaatc agtatgaggc aggcggaaaa gcaaaagttt      1380
     ctaagacacc aggatgaaga atacaaacaa atctctgtct ctcacgatga ggtggacaat      1440
     gctgttaacg gcataggtaa aggactaaag aagtcacaaa ttgataccct ttttgattcc      1500
     ggagtggtta aaaataagcc tcttctgaac cctacttcgg taatagacgc atgcgctctc      1560
     cttaaaaagc ccaagaccaa agatctcaaa gacagacaca gcccaaccgt atttgattcc      1620
     atcagaagag agaccttttc acccacagat atcgacagcc ttaactttat attaagcgaa      1680
     gggtctattg caaatagtaa agatttccta ccgggtcaac cctctacccc atcgccattg      1740
     caccagccac ccattcaggc ggaattaagt gccagggaat tatttcaacg tgaattacaa      1800
     aaattcgata atgacagaga tcccaattca attgtttcgt tgccggtcaa ctcttccttt      1860
     gcttctttgg acagttttta cattgataac tacgctgtga atgatacaaa cgtcgaagct      1920
     gaatttactc cctctttccc cacaaacgat cagcggattt catcttcata tcagcaattc      1980
     acttcttcta atttacccca caagggcgca agtgctcttc taagtccttt cagcaacatg      2040
     aacgtgtcgg ggacaccaaa agctcaggat aagatattag catcgccacc accgttgagc      2100
     ataaatacat tgcagcttga ttccaaaagg aatggtcgta ttcctcgagt cagcagtatt      2160
     ctttctccac aatctacaac taccagatcc agttctagtg cagagctctc acctgcggcg      2220
     tttgctagtc gcttccgaat gactccaaca gctgcaatag catcgtctga aagcgcaatt      2280
     aggcttgaca atagatcaca aaaatccgaa cttgctaccc ctcggttgtc cattggtaca      2340
     aatggaacat cacagacaat tcttgccaaa agatatgaca gttctcgaag tttagcctcg      2400
     caagtgacaa agtctactcc tttgaaacag ggaaatcctc cattaaccaa gaagattatt      2460
     tttcaagagt tacatgggag cgatgaagaa aaggattcaa taacaacgga ctcggctgca      2520
     tatatgagca ctgaatctgc tggtgagtat agctacgatg gcacaaaatc agatacagaa      2580
     tctcttccat ttgaatttgg tattgattcg gaacacggga gcgagatatc tttgcgaaat      2640
     gtccctgctg tcggcggtat cgattctttt tgccaacccg agacattaag cgcctcctct      2700
     gctagtactg caagcgatgc agatgatgat gaactggtat tcccccccag gcatgttgga      2760
     cgtagccgcc gtttttcctc ttccgcagac aattcctcta gcagggccct aggtgtttct      2820
     cagccagcga tctcagaaga agcaaccgat atagctcctg catctatatc tggacagcta      2880
     aaagcttctg acagcttgtc aactttgaca cagataaact ctgccaggac tgtgaatacg      2940
     ccatccggcg atggtgtaaa ctctgtacgc ctgaacactg atccaagcta tgttttgccc      3000
     gttagccaag atgttgaaga cagtattgat gttcccgcgg aggttttgca tatgatacct      3060
     gaattacata aacaagaccg aggaaatatg gatcctgtta ctcaaacagg cggagttcta      3120
     actaatagct ggttgctacc gcacacagct gcgcaggcca caacgcaaga ggcacatgtc      3180
     gatcaagtac tgattacgag ttcgcaagac cattctcatc atttgtcatc tagggatctt      3240
     ttacagagtg tattaagctc gtcggatact tcgcgacgct catcattgca tggtggaacg      3300
     tctgtacact caccgacttc tacctccgca gcccaagacg aaagtaggtt aatcaacgct      3360
     gccaaaaaac tagcacgtat acggaaaact gatgattctt ctgggttaac gatgtctttt      3420
     cgaaggcaaa gtcttgcacc tgaatttcgg cataaagaag ctcacagcaa gtctaggtcg      3480
     tgttctatat cgcttggaca gttggataag cggaacaatg acacactagg aagcccatat      3540
     aactaa                                                                 3546
//

If you have problems or comments...

PBIL Back to PBIL home page