(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE157

ASHGO_3.PE157        Location/Qualifiers
FT   CDS_pept        279017..279802
FT                   /codon_start=1
FT                   /gene_family="HOG000234606" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747822"
FT                   /gene_name="NSA2"
FT                   /locus_tag="ACL050W"
FT                   /product="Ribosome biogenesis protein NSA2 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51178.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG011932"
FT                   /db_xref="HOGENOM:HBG396800"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI000025279C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CG9"
FT                   /transl_table=1
FT                   /translation="MPQNEYIEQHIKKHGRRLDHEERKRKREAREAHKISEKAQKLTGW
FT                   KGKQFAKKRYAEKVAMRKKIKAHEQSKLKGAAKPLEDSGEALPAYLLDREQANSAKAIS
FT                   SSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEGFTR
FT                   RPVKMERIIRPSALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIE
FT                   VNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     atgcctcaga acgagtatat cgaacagcac atcaagaagc acgggcgccg tctggatcac        60
     gaggagcgga agcgtaagcg ggaggccaga gaggcgcaca agatatccga gaaggcgcag       120
     aagctgactg gatggaaggg taagcagttc gcgaagaagc ggtatgccga gaaggtcgcc       180
     atgcgcaaga agatcaaggc gcatgagcag tcgaagctca agggcgcggc gaagcccctg       240
     gaggacagcg gcgaggcgct gcccgcgtat ctgcttgaca gagagcaggc caacagcgcc       300
     aaggcgatct cgtcgagcat caagcagaag cggctggaga aggcagacaa gttctccgtg       360
     ccgctgccca aggtgcgcgg gatcagcgag gaggagatgt tcaaggtggt caagaccggg       420
     aagtccaaga ccaagagctg gaagcgcatg atcaccaagc acacgttcgt gggcgagggc       480
     ttcacgcgcc gccccgtgaa gatggagcgc atcatccgcc cgtcggcgct gcgccagaaa       540
     aaggccaacg tcacgcaccc cgagctcggc gtcacggtct tcctgcccat cctgggcgtc       600
     aagaagaacc cgcagtcgcc catgtacacg cagcttggcg tgctgacgaa gggtacgatc       660
     atcgaggtca acgtctccga gctggggatg gtcacgtccg gcggcaaggt ggtctggggt       720
     aagtatgccc agatcaccaa cgagcccgac cgggacggct gtgtcaacgc cgtgctgctg       780
     gtgtag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page