(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE16

ASHGO_3.PE16         Location/Qualifiers
FT   CDS_pept        27999..28874
FT                   /codon_start=1
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764783"
FT                   /locus_tag="ACL190W"
FT                   /orf_name="AGOS_ACL190W"
FT                   /product="ACL190Wp"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="AAS51038.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG460397"
FT                   /db_xref="HOGENOM:HBG742418"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000252710"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV6"
FT                   /transl_table=1
FT                   /translation="MSEILRAKVKVALVQLAGSSASKAANLARAGQFIERAMTEQPDTG
FT                   LVVLPECFNAPYEIGKFREFAEVAAEGPESPSVGFLAGQARRWGVTLVGGTIPELEPDT
FT                   QRVYNTCLVFDGKGALVGKHRKVHLFDVDIPGKITFTESRTLAAGRHVTQVDTPAGALG
FT                   VGVCYDLRFPELAMVCARRGAYAMVYPSAFNTTTGPLHWHLLARARSVDNQIYTLLCSP
FT                   ARVAGASYQAYGHSLVVDPTGRVVAEAGEGEEILYATLDPAELDWVRRAIPVTRQRRFD
FT                   VYADVAASSP"
     atgtctgaga ttctgcgtgc aaaggtcaaa gtggcactcg tgcagctggc cgggtcatcc        60
     gccagcaagg cggcgaacct ggcgcgcgcc gggcagttca tagagcgcgc gatgacggag       120
     cagccagaca cggggctggt ggtgctgccg gagtgcttca acgcgccgta cgagattggc       180
     aagttccgcg agttcgcgga ggtggcggca gagggcccgg agtcgccgtc ggtgggcttc       240
     ctggcggggc aggcgcggcg gtggggcgtg acgctggtgg gcgggacgat ccccgagctg       300
     gagccggaca cgcagcgggt ctacaacacg tgcctggtgt tcgacggcaa gggcgctcta       360
     gtcggcaagc accgcaaggt gcacctgttc gacgtggaca tccccggcaa gatcacgttc       420
     acagaaagcc ggacgctggc cgcggggcgg cacgtgaccc aggtggacac gccggctggc       480
     gcgctcggcg tcggcgtgtg ctacgacctg cgcttcccgg aactggccat ggtgtgcgcg       540
     cggcgcggcg cgtacgcaat ggtgtacccc agcgcgttca acacgacgac cgggccgctg       600
     cattggcacc tgctcgcccg cgcgcgcagc gtcgacaacc agatctacac gctgctgtgc       660
     tcgcccgcgc gcgtcgccgg cgcgtcgtac caggcgtacg gccactcgct cgtcgtcgac       720
     cccaccggcc gcgtcgtcgc agaggccggc gagggtgagg agatcctgta cgcgacgctc       780
     gaccccgcgg agctcgactg ggtgcgccgc gccatccccg tcacgcgcca gcggcgcttc       840
     gacgtctacg cggacgtcgc ggcctcctcc ccttag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page