(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE188

ASHGO_3.PE188        Location/Qualifiers
FT   CDS_pept        complement(328045..329772)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747836"
FT                   /gene_name="HRD1"
FT                   /locus_tag="ACL019C"
FT                   /product="ERAD-associated E3 ubiquitin-protein ligase HRD1 "
FT                   /EC_number="6.3.2.-"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51209.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058359"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001DB27C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC8"
FT                   /transl_table=1
FT                   /translation="MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSG
FT                   VHFVIWGNFLIVHYCLFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTY
FT                   MAGHMTILFYTLCLVAHWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKM
FT                   LKFCVQNTNVDGKRHDLYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVY
FT                   EGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRS
FT                   IKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRA
FT                   KMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAREQTPPDLLQERGID
FT                   EHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCMNQAYDGGLLSHEERDQAGWVAFPIEF
FT                   RADNKVFFNLNDSQGDRQWMASYTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGT
FT                   SSQVDVTVSAKDAPANACFVIATSKLEQTKEVEHLKRKVEELESRVEELSKRIKTDQV"
     atgcctcggg aagtttcctg gcccatgtgg gcaatgttta taacagcgac gtatgccttg        60
     gcgggatggt cggcgtatag ctgtgcaacg agctttgatg accccttgag tgccttgttt       120
     atggcgagca gtggcgtcca ctttgtgata tggggcaact ttcttatagt acactactgc       180
     ctatttgtgt gggcaataat acgagtactg tttggacagc tgacagcaat agagtacgac       240
     cacatatttg agcggctgca tgtagtgctg gtaactctag cctcgatcgt tattacgatg       300
     cgcaaaacgt acatggcggg ccatatgacc attttgtttt ataccctttg cctagttgcc       360
     cactgggtgc tgcgcgaccg aatggacttc gtcttccagg tgcacgggac cgactcgagt       420
     ctgctgggta tactgtgctc gcgatttatg tttagtttgc tagtgctggg catggttgac       480
     tataagatgc tgaagttctg tgtgcagaat acaaatgttg atgggaagcg ccatgacctg       540
     tatttgatgc tggcgctttc gttcgctcag ctgattctcg atgtgctaca tgttgtactg       600
     ctaacaagtt tgaacttgtt tgagatggtg cgctccagga gaactcggag cgccaatcta       660
     gtgtacgagg gcggtaccac agacgatgat gcagacgacg aggtatttat ccttgagggt       720
     aagtacatat acgagacagt gtttgatttg acgataacag ttttgaaggt gatactagac       780
     attatacagg aggtctttgt gccgtggtcc atcactgtgg tctacagtat atttgtgcgc       840
     agcataaaag ctggagaaag ctttctgctt gtctacaact actggaagaa caataagaag       900
     ctgtatgaaa agctatctga tgtatcagag gagcagttgg atgacacgga ctcgatgtgc       960
     atcatttgta tggacgatat gcttccaaca accgagacga ctaaaatgaa tagacgtgcg      1020
     aagatgctgc cttgtggcca tatgctacat tttggatgtc tcaaaagctg gatggaaaga      1080
     tcacagacat gccctatttg ccggctttct gtgtttgcta atgatagtaa ttcacatgcc      1140
     actactcagg cgcgcgagca gactccccca gatctacttc aagaacgtgg tattgacgaa      1200
     cacatagatg tcatcggtat gcaggatatg agtgtgcagt caatctcgct acacgaaggt      1260
     actgcagttc gcaggggtac caccggaaac tgtatgaatc aagcgtatga tggaggattg      1320
     ctgagccacg aggagcgaga ccaagcagga tgggtagcgt ttcccattga attcagggct      1380
     gataacaagg ttttctttaa cctcaatgat agccaaggcg ataggcaatg gatggcttcc      1440
     tatacctcgt atccacgtca aaatatggta aattcagatg atccagataa cgcttcagag      1500
     agccattcaa gaataccatc accctcactt cccggctctc tggagggtac gagttctcag      1560
     gttgatgtga ctgtatctgc caaggatgcg cctgctaacg catgttttgt gattgcgaca      1620
     tcaaaactag aacagacaaa ggaggtcgag catttgaaga gaaaagtaga ggaattagaa      1680
     agcagagttg aagaattatc gaaaaggatc aaaaccgacc aggtgtaa                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page