(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE193

ASHGO_3.PE193        Location/Qualifiers
FT   CDS_pept        complement(333901..335472)
FT                   /codon_start=1
FT                   /gene_family="HOG000000751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927734"
FT                   /gene_name="MVP1"
FT                   /locus_tag="ACL014C"
FT                   /product="Sorting nexin MVP1"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51214.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058360"
FT                   /db_xref="HOGENOM:HBG203374"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001DB27C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC3"
FT                   /transl_table=1
FT                   /translation="MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVVR
FT                   QAESLGSLTLTDSSLSAEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASISGL
FT                   DTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNY
FT                   LVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIF
FT                   LARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDK
FT                   AFISLWHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEF
FT                   ADNSVTLYPLEEGTIHDINSHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIII
FT                   ALKGVFDRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTI
FT                   AEQLNRSWLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANETTESWEKVYANLQD
FT                   MPLSRS"
     atgatggatt tggattctca agagttgtgg gggcgtggac cttctatgga atcaccaaac        60
     aacgcgtggg ccagtgtaca acgaactccc gccgatagcg ctcgtacgca gcagatagta       120
     tcacccgttg ttcgacaggc tgaatctttg gggtcgctca cattgacaga ttcatcgctg       180
     tcagcagagg tgaaggagac tatgcgtaat aattacaatg agcgaaagat gtacgagccc       240
     ggcacgccag cgttggaaca gacagtgtgg ggagcgccac catcacaact agacgcaagt       300
     ataagcgggc tagatacttc gatggcacca gtagccagcc agagctccat gtgcgacgaa       360
     ctacacagcg aagatcttga gaattggatg aatagtcggc gaaagacgta caatccctta       420
     gccaagaaca tcgtcgtggt agaagagatc cccgagcggg agggcatcct cttcaaacat       480
     acgaactact tggtcaaaca tctggttgtg ttaccaaata cgaatccctc ctccaaccag       540
     acagtcattc gtcgctactc cgacttcaac tggcttcagg aagttttatt gaagaaatat       600
     cctttcagaa tgatccccga gttgcctccc aagaagatag gggcgcagaa cgcggatccc       660
     atcttcttgg ctcgcaggcg taagggtcta tgccgtttta ttaatcttgt tattatgcat       720
     cccgttctca aacaggacga cctagttctg acgtttctaa ctgttccaac ggacttggga       780
     agttggagaa agcaggcaaa ctatgacact actgaggaat ttactgacca gaagatcgat       840
     aaggcgttta tcagtctctg gcataaggag ctcagcaacc agtggaataa agccgatgcg       900
     aagattgatg agctgctaga gtcatggatt aagacttccg tccttgtgga gagatacgaa       960
     cggcgcatga ggcaggtgtc tgaagagcgg cggctgcttg gccgcgtgat tgaggaattt      1020
     gctgataatt cggtaacact atacccacta gaagaaggca ctattcatga tattaactct      1080
     catatatcca ctatatcaaa acatctcaat agcctggccg atacctctaa gaaggagcgt      1140
     caggaagtgg aggaacacct atcggtgaag tttaagacct tcatagatat tattatagca      1200
     ctgaaggggg tctttgatag gtataaaatt atggcgggga ataacatagc acatttgcag      1260
     aggagagtgg aaataaatat ggacaaactt caatctatgg agagtaatcc ggacgttaaa      1320
     ggtgcagaat atgataaact cagacagaca attcaacggg acaaacggac aattgctgag      1380
     caactaaaca ggtcctggct aattagaaag tgcattttag aggaatttgt aattttccag      1440
     gagactcaat tttgtatcac acatgtcttc caggaatggg ccaagatgca tgtaaagtac      1500
     gccaacgaga ccactgaaag ttgggaaaag gtgtatgcaa atttacaaga tatgccgcta      1560
     tcgagaagtt ag                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page