(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE194

ASHGO_3.PE194        Location/Qualifiers
FT   CDS_pept        complement(335715..336509)
FT                   /codon_start=1
FT                   /gene_family="HOG000000775" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748928"
FT                   /gene_name="MDM12"
FT                   /locus_tag="ACL013C"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   12"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS51215.2"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG058361"
FT                   /db_xref="HOGENOM:HBG202793"
FT                   /db_xref="UniParc:UPI0001DB27C9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC2"
FT                   /transl_table=1
FT                   /translation="MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDF
FT                   KLGTIPPRITLKQIDNPLDDFYEALRLEGASIGGRDTDVQFLMEVDYKGDMLIELSAEL
FT                   VLNYPSPNFMQLPVKLTISDIGIHSLCLVAYLQRQLFISFLCDVSDPALDNVESPLDSN
FT                   GPAFLGSKAVERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAA
FT                   WPSWINLDFNEDVSADVESSSSAEESLPHRDDAQDFSADARA"
     atgtcatttg atataaactg gaataagatc aacgaggata gcaccattaa ccagcgagcc        60
     cgcgcttttc tcaatgagca tctcgaatcg ctgcagctgc ccagttatgt gagcaacatc       120
     aaaatgaccg atttcaaact cgggacaata cccccacgca tcactctgaa gcagatagac       180
     aaccccctgg acgacttcta tgaggcgttg cggcttgagg gcgcgtctat cggcggccgc       240
     gacaccgacg tgcagtttct gatggaggtg gattacaagg gcgacatgct gatagagctg       300
     agtgcggagc tcgtgctcaa ctaccccagc cccaacttta tgcagctgcc cgtcaagctc       360
     acgatcagcg atattggcat ccactccctg tgtctggtgg catacctgca gcgccaactc       420
     ttcatcagtt ttttgtgcga tgtcagcgat cctgcgctgg acaacgtgga gtccccgctg       480
     gacagcaatg gcccagcgtt tctggggtcc aaggccgtgg agaggatatc tctcatacgg       540
     agcatcaaga tacagacgga aattgggccc caggatctga gcgagggcac cattttgcgg       600
     agcgtgggca agctggagca atttctgtcc gatgtgttca agaacttact tcggaaggag       660
     gctgcctggc cgagctggat caacttggac tttaacgagg atgtctctgc cgacgtagag       720
     agtagcagtt ccgcggaaga atcgctcccg cacagagacg atgcacagga cttctctgcc       780
     gatgcgagag catag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page