(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE195

ASHGO_3.PE195        Location/Qualifiers
FT   CDS_pept        336672..337286
FT                   /codon_start=1
FT                   /gene_family="HOG000000776" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622160"
FT                   /gene_name="COQ10"
FT                   /locus_tag="ACL012W"
FT                   /product="Coenzyme Q-binding protein COQ10, mitochondrial "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51216.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG110424"
FT                   /db_xref="HOGENOM:HBG397391"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI00002527C1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC1"
FT                   /transl_table=1
FT                   /translation="MLRCLISRPQLLPTRLPLATPSCVSRRTFLGFTGGDTKEQRYILK
FT                   RVFNAPLHYVYPAVSEVSLYKLFIPYCTDSFVNKRRPGDNMPTEAGLRVGFQQYDETFV
FT                   CRVDCTTLPGNQRSVVAESLAHHLFETLHTQWLLSPHPTRPDASVVELILRFKFKSQLY
FT                   NSVSSIFGTRVTQVVMKAFEKRVFQLRKEAMDRPPTGDAGH"
     atgctccggt gtttgataag ccgccctcag ctactgccta caaggctccc tctggctacg        60
     ccgagttgtg tatccagaag gacatttctt gggttcaccg gcggtgacac taaggagcag       120
     cgttatatcc tcaagagggt cttcaacgcg ccgctgcact acgtgtaccc tgcagtgtcg       180
     gaagtgtccc tctataagct tttcattcct tactgcacgg actctttcgt taataagcgg       240
     aggcctggcg ataacatgcc caccgaggca ggccttcgtg taggcttcca gcagtatgac       300
     gagacgttcg tgtgccgggt agactgcacg acgctgccgg ggaaccagcg aagcgtggtt       360
     gcagagtcgc tggctcacca cctattcgaa acgctgcata cacaatggct actctcgcct       420
     caccctacca gaccggacgc ctctgttgtg gagctgatcc tgcggttcaa gttcaagtca       480
     cagctttaca acagtgtctc ctcgatcttt ggcacgcgcg tcacgcaggt ggtcatgaag       540
     gcgttcgaga agagagtctt ccagctgcgg aaagaggcca tggacaggcc gccgaccggt       600
     gacgctggcc actaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page