(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE209

ASHGO_3.PE209        Location/Qualifiers
FT   CDS_pept        complement(359761..360387)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748935"
FT                   /locus_tag="ACR003C"
FT                   /orf_name="AGOS_ACR003C"
FT                   /product="ACR003Cp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS51230.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1KAO"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00002527CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CA9"
FT                   /transl_table=1
FT                   /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADF
FT                   LTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWR
FT                   DEFLVHANVPSPESFPFVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAI
FT                   NVDDAFEEIARSALQQSQADAGAYEDDFNDAINIQLDGEPSSCNC"
     atgtcatcta gaaagaagaa cattctaaaa gttatcattt tgggtgattc cggggtgggc        60
     aagacatcct tgatgcaccg ttatgtgaat gataagtaca gccagcagta taaggcaaca       120
     attggcgccg acttcttgac caaggaggtg acggtggacg gcgacaaggt ggccacgatg       180
     caagtttggg atactgctgg tcaggagagg ttccagtctt taggcgtagc cttctatcga       240
     ggggccgact gctgtgtgct agtttatgac gtaaccaatg cgaagtcttt tgaaaacgtc       300
     aaatcctggc gtgatgagtt cttggtgcac gccaacgtgc catcgcctga gtctttcccc       360
     ttcgtgatct tgggcaacaa gatcgacgtg gaggagtcca aaaaggtggt caccactcgc       420
     acctcccagg agttggcgaa gtctttgggc aacattccat tcttccttac cagcgcgaag       480
     aacgccatca acgtcgacga cgctttcgag gagatcgccc gcagtgctct acagcaaagc       540
     caggcggacg caggcgcgta cgaagatgat ttcaacgacg ccatcaatat ccagttggac       600
     ggggagccca gctcatgtaa ttgttga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page