(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE216

ASHGO_3.PE216        Location/Qualifiers
FT   CDS_pept        complement(374084..376921)
FT                   /codon_start=1
FT                   /gene_family="HOG000248614" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748939"
FT                   /gene_name="CIN8"
FT                   /locus_tag="ACR010C"
FT                   /product="Kinesin-like protein CIN8 "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="cell division"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS51237.1"
FT                   /db_xref="EMBL:AAN87133.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG398095"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000006CAFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1G7"
FT                   /transl_table=1
FT                   /translation="MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVV
FT                   TVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMK
FT                   GYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVK
FT                   CSYIELYNEELKDLLDESHDSSKRLRIFDSSSMNHSSRASSQSNSPREPEVAHNGFSRR
FT                   RQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTK
FT                   MNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQ
FT                   SLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSST
FT                   LEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEI
FT                   VNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDK
FT                   IERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMN
FT                   QHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLK
FT                   EFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVY
FT                   QKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASC
FT                   DNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCD
FT                   QSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSV
FT                   ETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSPIKTLDTNVRIISPVKRG
FT                   TIEFGAEGPPTKKVR"
     atgcctgatc acgaagtaca gacgaggaaa tccaggatgc ttgatgacgc acaggaagag        60
     ctgaatatca ccgtggccgt gcgttgtcgt gggcgaaatg agagagagat caaggcgaaa       120
     agttctgtcg tcgtgacggt gccggacgta acaggctcca acgaggtttc catcaataca       180
     acagacgaag tagggattgc ggcaaagatg aactcgcgca catatacggt cgataaagtc       240
     ttcgggccta gtgcagatca gagcttaatc tttaaagaaa ttgcagagcc gttgtttgat       300
     gacttcatga aagggtacaa ctgcaccgtg ctggtttacg gaatgacatc tacgggtaag       360
     acttacacga tgactggcga tgaaaaacta tatgacggac aattgagcga ctctgcgggg       420
     ataatcccaa gaatcatgtt taagctgttc gatgccctag aagccactga cagcgatttt       480
     ctggtcaaat gttcctacat cgagctttat aacgaagagt tgaaggactt actagatgag       540
     tcacacgatt cctctaaaag attgaggatc ttcgattcta gctctatgaa ccacagcagc       600
     agagcaagct ctcagagcaa ctctccgaga gaaccagaag ttgcacataa cgggtttagt       660
     agaagacgac aacggccgcc ccctgtgaaa gccaaccgga tgtcagcaac aaagcaacaa       720
     ctttctgaaa gcggctcggg catatatgtt cagaacgtgc aagagttcca tattatcaac       780
     gcgcgagagg gcattaacgt tctgcaaaag ggtttaaaac acaggcaagt agcttcaacc       840
     aaaatgaacg acttttctag caggtcgcac actatattta ccataatgct atacaagaac       900
     tgtgacgggg agttatttcg agtatcgaag atgaacctag ttgatcttgc agggtctgaa       960
     aacatcagcc gatctggagc tcaaaatcaa agagcaaagg aagcaggctc aatcaaccaa      1020
     agtctactga ccttgggtcg tgtgataaac tcccttgcag ataaaagcat tcatattcct      1080
     tttcgcgaat ccaagctaac gagacttctt caagattccc tcggaggaaa tacaaagact      1140
     gcgcttatag caaccatctc gccagcgaaa atcaatgcag atgaaacttc gagtactctg      1200
     gaatatgcgg ccaaagcaaa gaacatcaaa aataggccgc agcttggtgc tctcatgatg      1260
     aaggatatac tggtgaaaaa tatatcgagt gaacttgcca aaataaagtc agattttcta      1320
     tcgactaaat ctaaagatgg tatatatatg agccatgagc attaccaaga aatcgtcaat      1380
     gatttggaga actgtcagac agaaattcag gaatctaagc ggcagataga gtctctaaca      1440
     tcccagaaca atcttctctt aaaagataaa aaggcgtcgc aagaggtaac tgagttgcag      1500
     aatagcaaga ttaagaagct tcagagtact atagagtatc tttatgataa aattgaaaga      1560
     caacatcaca acgaaacgga acttgcgaca actattcaca agttgaaaga agctcttcat      1620
     actatgcagg ggtctttgaa aagctatgaa acacatgaat tgcgactaca aaatgatatt      1680
     aaagaagttt tgtatcaggg cattacctct tatagagaat ctatgaacca acatcttgag      1740
     aaagttaagg ttagcatgct ggataagaat ctgtccatca aagaaaacat aaataacata      1800
     accaccattt ttgacgatac actcaagtct gtggaggcaa atggttcaga tatgtgtgat      1860
     accctagtga agttgattaa agaaaccccg tcgatgtacc tgaaggaatt taacgagaca      1920
     gtatcgtctc taaagtcgga attatcctct tattcaaacg ctttaactaa taagttgaca      1980
     gagattagtg aagaaaataa tcacctacgt gaatatttgg atcagcatct tttcaagaat      2040
     agtacccagg aagtcctcga tttgagaatg gagagtgttt accagaaggt caagaatgat      2100
     tctgatcaat tattatccaa gcttgtctcc atggttggag cgcatgttga agagagcaga      2160
     acactgatgg taaactccat gaaggacacg gtgaatgaaa ttatagataa cgagcgtagc      2220
     ttattccaac caatcagaga tcggtggatt gcttcatgtg ataatatcaa ccaatgcgac      2280
     gcatcccacc agaattttga agcgaaatcc actagtggtt tggataaact caaagaacta      2340
     tctgatgctt cgttaaaaag ttcagaagat gcagtaaaca aggctaaaca tagaacggat      2400
     agctttcacg actttgttca aaaactatgt tgtgatcagt ctctgaaaaa acaaatgcat      2460
     gatatcagtg acaagcatag aatgctggag gaccatttcg acgacaacgt caaatacttc      2520
     aaagaatcaa gtaagggctt cgaagacatg gactgttcca taaagaagat catacatgag      2580
     atgagtccgg aagtcggaga catcaagtct gtggaaacgt tgatggaacg gatcaacgcg      2640
     agaacattta gtccagttag gcccaccggg aagacgccat cgagacaagt tctcaaaaat      2700
     gctattacat cgaaagccag ttctagatct atgtctccaa tcaagaccct tgatacaaat      2760
     gtgcgcataa tatctccagt gaaacgcgga acgattgaat ttggagcaga aggtccaccg      2820
     actaaaaagg ttaggtga                                                    2838
//

If you have problems or comments...

PBIL Back to PBIL home page