(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE218

ASHGO_3.PE218        Location/Qualifiers
FT   CDS_pept        complement(378749..380374)
FT                   /codon_start=1
FT                   /gene_family="HOG000199176" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774719"
FT                   /locus_tag="ACR012C"
FT                   /orf_name="AGOS_ACR012C"
FT                   /product="ACR012Cp"
FT                   /function="identical protein binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="negative regulation of catalytic
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS51239.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0042802"
FT                   /db_xref="GO:0043086"
FT                   /db_xref="HOGENOM:HBG540727"
FT                   /db_xref="HOGENOM:HBG752219"
FT                   /db_xref="HSSP:1AH2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00002527D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CA0"
FT                   /transl_table=1
FT                   /translation="MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMAR
FT                   ENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVA
FT                   RLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNP
FT                   HVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVID
FT                   TGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVL
FT                   RSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVD
FT                   AGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNIL
FT                   STYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDF
FT                   GTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLI
FT                   HELESSTDAMFSGFRTILDRMNII"
     atgaagttgc agcgtgcagt ttggccggca gtggcgttga ccacggcgca ggcactcctc        60
     attttgccac aggcggagga cgagttggtg gtggcggagg cgcaccgcgg gcagttggtg       120
     cagtggatgg cgcgggagaa ccaggagcgc aaggcgcagg gcgcggagca gcagtctccg       180
     ttgttccgcg tggacgacgt gacgcgcgcc atcccacaca agtacattgt ggtgttccgc       240
     gagggcgtga gcgacgagga ggcggcgttc cacatggagc tcgtggaggc ggcgcacgcg       300
     gagtcggtgg cgcgcttgga cgagcagcac gcgttcttcc ggtcgacgcg cggcgagaac       360
     aacgagttcg ggattgcggc cacgcgggcg gagggcggca ttgagggcga gtttgcgctc       420
     ggcgagcagt tgcgcggcta cgtggggtac ttcacggagg acatggtggg gttgttgcgg       480
     tcgaacccgc acgtgcactt cgtcgaggag gactccatgg tgtttgcatc cgacttcacc       540
     acgcagaacg gcgcgccgtg ggggttggcg cgtgtgtcgc accgcgagaa gttgaactcc       600
     ggctcgttca acaagtacct ctacgacgac aactcgggcg agggcgtgac gtcctacgtc       660
     atcgacaccg ggatcaacat cgaccacgtg gacttcgagg accgcgcctt gtgggggaag       720
     acgatcccca acaacgacgc ggactacgac ggcaacgggc atggtacgca ctgtgcgggc       780
     acgattgcgt ccaagaccta cggtgtggct aagaaggcca acgtcgttgc ggtcaaggtg       840
     ctacggtcga acggtaccgg ctcgatgtcc gacgtgttgc gcggcgttga gtacgcggtg       900
     aaggcccacc gtaaggcggc cgaaaaggcc gacaaggggt tcaagggctc cacggccaac       960
     atgtccctag gtggcggtcg ctcccaggcg ttggacctgg ctgtcgacgc cgccgtcgac      1020
     gctggtatcc actttgcggt ggccgccgga aacgaaaacc aggacgcctg caacacctcg      1080
     ccagctgcgt cgcagaaggc cattactgtg ggtgcctcca cattggccga cgacagagca      1140
     tacttttcta actggggccg ctgcgttgac ctattcgctc caggcatgaa catcttgtcc      1200
     acctacattg gctcagatac cgccgtcgct actctttctg gtacatcgat ggcttctcca      1260
     catgttgctg gtctattgac ctactttttg tctttgcaac ccgacggaga ctcggagttc      1320
     cgcaacaagc agacgatatc cccagaggtc ttgaagaaga aggtcatcga cttcggtaca      1380
     aaggacgctt tgagcagcct accagcaaga accgccaacg tgttgatata caacggtggt      1440
     ggcgcggact tgtccgactt ctggggcaac aagcccaaga aagtcagcgg tcctaaattc      1500
     acctacgcag atgacgagga agccatgggc tccgacttgg accgtctaat ccacgagctt      1560
     gagtctagca ctgatgctat gttttccggt ttccggacca tcttggaccg gatgaacatc      1620
     atttaa                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page