(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE223

ASHGO_3.PE223        Location/Qualifiers
FT   CDS_pept        387121..388392
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078981"
FT                   /gene_name="HAT2"
FT                   /locus_tag="ACR017W"
FT                   /product="Histone acetyltransferase type B subunit 2 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51244.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00002527DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C99"
FT                   /transl_table=1
FT                   /translation="MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVE
FT                   EEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKV
FT                   ATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKG
FT                   TISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKP
FT                   KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSF
FT                   SKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR
FT                   RAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI
FT                   QAWKVSMKLVNASPPAISDPSLLV"
     atgacgacga agcttaaagg tttaaaggaa cttgggaata cttcggatcc attgcggaca        60
     gtcagctatc aagtacgaac caagatgtct gattatgagg atgacaacac ggatgtgcag       120
     agtctaacag tggaggaaga atacgagctc tggaattcca atgtgccagt tatgtatgag       180
     ttcgtcagcg aaacaaaatt aacctggccc tccctgacta tccagtggct gccttccgat       240
     ggtcagagcc cggaacagag tcttattttt ggtacacata ctgcaggcga agaggtgaat       300
     tatttaaagg ttgctacaat aaatcttcct gcaggaattg ctggcctgga ccaaggagat       360
     gaagaggacg aagccaatga ccactcctca tttgcaattg ccaacaaatt tccccacatc       420
     gaggaagtga tcagggcgcg gtacatgccc gcgaatagca acatcattgc tacgataaat       480
     ggtaagggaa ccatatctat attcgaccgt actctagagg agtcgaaggc ccaggtttcc       540
     acattggcgt tccacaagga aaatggatac gggttggcgt ttaacccgca catctctgga       600
     gaacttttat ctgggtctga cgacactacg gtcgcattgt gggatattga ggcagcgaag       660
     aaacccaaaa gcatattgac gtcccatgac gacatagtga acgatgttaa gtggcacgag       720
     ttcgagagca atgtctttgg gacagtgtcc gaggacaaga ccttacaggt gcatgacaaa       780
     cgggtcaggc tggagcccgt gaagaagttg cctactgcgt caccgttcaa cacgttgtcc       840
     ttcagcaagc actcaaggaa cctcttggca gctgctggtg tggattccca aatatacttg       900
     tatgacatga gggatatgtc ctcccctcta cacgtcatga gcggccacca ggattcggtg       960
     accacggttg aattctcccc acacactgat ggtatcatat gcagcagcgg ctccgatcgg      1020
     agggccatca tttgggattt gacccagatt ggcgccgaac aatcccaaga tgatgctgac      1080
     gacggcgccc cggagttaat gatgatgcac gctggccata ggagccctgt gaacgaattc      1140
     agtttcaacc cccagattcc atggctgttg gctagtacag aagaagacaa cgtgatacaa      1200
     gcttggaaag tgtccatgaa attggtcaat gcctcacctc cagcaatatc tgaccccagc      1260
     ctcctcgtat ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page