(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE23

ASHGO_3.PE23         Location/Qualifiers
FT   CDS_pept        37474..38178
FT                   /codon_start=1
FT                   /gene_family="HOG000093236" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747754"
FT                   /gene_name="TIM21"
FT                   /locus_tag="ACL183W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM21"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51045.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058380"
FT                   /db_xref="HOGENOM:HBG204342"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI0000252717"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CX4"
FT                   /transl_table=1
FT                   /translation="MLAFGSICGRLRAPAGAGLRVNVGKMPGRAWQVANGQPYSTFYAP
FT                   PEQAGNRQKERRVTAWKKVRAAATFSASGMLVLGAAGVAGIVLYLILSELFSPSGDTQI
FT                   FNRAVSTVEGDAVARSLLQCEDGVHRSERLKAYGDSVGDDRWTRNRPISSTRRLDASGR
FT                   EHYYMRFHVETGRRRGVVSLEAQQSDDSYQPEFVRMYLDVPGEKRHYLIRPEPSVAKPK
FT                   GFLGLNWGPRKD"
     atgttggcgt ttggaagcat ctgtggacgg ctgcgggcgc cggccggcgc gggattgaga        60
     gttaacgtgg ggaagatgcc aggccgcgct tggcaggtgg cgaacgggca gccatactcg       120
     acgttctatg cccccccaga gcaggcgggc aaccgccaaa aggagcgccg cgtcacggcg       180
     tggaaaaagg tgcgggcagc agcgacattc agcgcgtcgg gtatgttggt actgggggct       240
     gcaggggtgg cgggaatcgt gctgtacttg attctctcgg agctcttctc gccctcgggt       300
     gacacacaga tattcaacag ggccgtctcg acagtggagg gcgacgcagt tgcgcggtca       360
     ctgctgcagt gcgaagacgg tgtgcataga tccgagcgtc tcaaggcgta cggcgacagt       420
     gtcggtgacg accggtggac acgcaacagg ccgatcagct cgacccggcg tctcgacgcc       480
     agtggccgcg agcactacta catgcgcttc catgtggaga ccggtcgccg gcggggtgtg       540
     gtgagccttg aggcccagca gtcggacgac agctaccagc ccgagtttgt acgcatgtac       600
     ctggatgtgc caggtgagaa acggcactac ctcatcaggc cggagccgtc ggttgcgaaa       660
     cccaagggtt tcctgggcct gaactggggt ccccggaagg actag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page