(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE24

ASHGO_3.PE24         Location/Qualifiers
FT   CDS_pept        complement(38290..39900)
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621884"
FT                   /locus_tag="ACL182C"
FT                   /orf_name="AGOS_ACL182C"
FT                   /product="ACL182Cp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS51046.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252718"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CX3"
FT                   /transl_table=1
FT                   /translation="MKLQAVLAKTALFSAAVAKASQNTTLAQSGLPVIEVVGNKFFDSR
FT                   SGEQFFIKGIAYQPSSAPQELEVGYPADTKYIDPLAEVEICKRDLPYLKKLGVNTIRVY
FT                   SIDPTKPHDVCMEELSKLGIYVLIDLSEPDTSIIRETPTWDVKVFQRYKDVVDSMQKYN
FT                   NVLGFFAGNEVTNDRTNTDASPFVKAAIRDVKNYIKQMGYRTLPVGYSTNDDQETRDHL
FT                   ADYFVCGSVSADFYGINMYEWCGHSSYGTSGYRERTNEFRNFPVPVFFSEFGCNTIRPR
FT                   PFTEIQALYGTMMTPVWSGGLAYMYFEEDNEYGVVKVTKDNQVLELPDFRNLQKEFEKA
FT                   RPKGVKRSVYEKTYKVNSRTCPEKSATWKASEELPPTPDARKCGCLEQALPCLSLSLQD
FT                   PMSYKNYFEYVCGFVNCMDINGDGSLGVYGEYSDCDTRQKLSLQLSKLYLRRKISKNEC
FT                   PIASNDFFFNAKSIGIPQQCQGVMEDVKVQANKKLVEPKPAAPAGKDVNAAGSSALHRL
FT                   NTATLVLVSTTAFIFHLLL"
     atgaaacttc aggccgttct agcaaaaact gcgctattct ctgccgcagt cgcaaaggct        60
     tcgcagaata cgactcttgc ccaatcaggg cttcctgtca tcgaggttgt tggcaacaaa       120
     ttctttgatt cacgttcagg tgaacaattt ttcataaagg ggatcgctta ccagcccagt       180
     agtgcgccac aggaacttga ggttggctat ccggctgaca cgaagtatat cgaccctttg       240
     gcagaagttg aaatatgtaa acgggatttg ccgtatttga aaaagctcgg agtcaatacc       300
     attcgtgttt actccattga tccaaccaag ccacatgacg tttgcatgga ggagttgagc       360
     aagctgggaa tctacgttct catcgattta tcagaaccag acacctctat aattagggaa       420
     acaccaacat gggatgtaaa agtattccag cggtacaaag acgtagtaga ctccatgcag       480
     aaatacaata atgttttggg cttttttgct ggtaacgagg tcactaatga ccgcacgaac       540
     acagacgcat cgccttttgt gaaggcggct atcagagatg tcaaaaacta catcaagcaa       600
     atgggataca gaactcttcc ggttggatac tcaacaaacg atgaccagga gacgagggat       660
     cacttggctg actacttcgt ctgcggtagc gtatctgcag acttctatgg cataaatatg       720
     tacgaatggt gcgggcattc atcttacggc acgagcggct acagagagcg gactaacgag       780
     ttcagaaact tccctgtgcc ggtgttcttt tcggagtttg ggtgtaatac aatcaggccc       840
     aggcccttca cagaaataca ggccttatac gggaccatga tgacgcccgt atggtccggt       900
     ggacttgcat acatgtattt cgaggaagat aacgaatacg gtgtggtcaa ggtcaccaag       960
     gataaccaag ttctagagct cccagatttc cgcaacctac agaaagaatt cgaaaaggct      1020
     cgccccaagg gggtaaagcg cagtgtctac gaaaagacat acaaggtcaa ttccagaacc      1080
     tgtccggaaa agtccgccac gtggaaggca tctgaagaac tacctccaac gccagatgca      1140
     cgtaagtgcg gctgcttgga gcaggctttg ccctgcttgt cgctcagcct acaagaccca      1200
     atgtcataca agaactactt tgagtatgtc tgcggattcg ttaactgtat ggacatcaac      1260
     ggtgatggaa gtttgggggt gtacggtgaa tattcagatt gtgacacaag acaaaaattg      1320
     agtttacaac tcagtaagct atatttgaga cgtaaaataa gcaaaaatga atgtcccatc      1380
     gccagcaacg atttcttctt caatgccaag agcataggca ttccgcaaca atgccagggc      1440
     gttatggagg atgttaaagt tcaagctaat aaaaagctag tggagccaaa gcctgctgct      1500
     ccagctggca aagacgtcaa tgctgccggt tcaagcgcat tgcaccgcct aaacacagcc      1560
     acattggtat tggtgtccac caccgctttc attttccacc tccttctata a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page