(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE242

ASHGO_3.PE242        Location/Qualifiers
FT   CDS_pept        complement(423040..425295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927740"
FT                   /gene_name="FYV8"
FT                   /locus_tag="ACR036C"
FT                   /product="Protein FYV8"
FT                   /protein_id="AAS51263.2"
FT                   /db_xref="HOGENOM:HBG058388"
FT                   /db_xref="UniParc:UPI0001DB2802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C80"
FT                   /transl_table=1
FT                   /translation="MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHET
FT                   ICKLPELPKLNLGGSTEERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGA
FT                   AAQKFSLTSSSRSVSSMNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGVPAL
FT                   KPEGHLADDSSDSDGEDAAGGSSLSQSFEHLNMSLKTDTASGQAMPLSSPRGSSALPAG
FT                   RDSLALKKGASPDRASEGSLSSRSEDLLAVDRTAGENTRLKTTNSSDDDTDSLPELITS
FT                   DAKFRADGASGPARVVSSGVETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSEDDSEAY
FT                   SGIEDDYLSYQPSPNISDAATFHGHRSRTGSPARAPHPLVEQEEHIELPVISDDDSTSK
FT                   SSVRDNYYSEESDNTTSQALVTQDNSSHDTIHDTIRERSFDKSTSGSVTHSIPVIKDDN
FT                   EDWQNQLRQQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMCGSQDEETTGDDQQLAEP
FT                   CNDDSDSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSEL
FT                   TSRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPV
FT                   PSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQSSSNITFDEYV
FT                   ISKHVQDAYAQAEEVSKKHSVTNAVNQNVSQLRKKVFSHSMKEGAKGLLSSIGKKKL"
     atgcccgaca aggtcaatag gaggaagtcg cagaggtggg tttcagtttc gaagggcaac        60
     tacgacggtg cggactggga tagcgactac tctggagagg agctcgagtc atcgccgacg       120
     cggcagcacg agacaatctg caagctgccg gagctgccga agctgaacct gggaggcagc       180
     acggaagaga gagggcggcc gggcagcggc gacggtctgg cgccgcgggg cgcagcggaa       240
     gaggaagcgg ccagcagcgg acgtggggcg gcgacgccgg ctcatgaggt gcagacgccg       300
     cggagcggcg ccgccgcaca gaagttctcg ctcacgtcgt cgagccgctc tgtgtcgtcg       360
     atgaacaagg aattggatac cctcatggac gaaatatcga aagagatgac tgcgggcggg       420
     tccgagcctc cgcttgtgga aacacgccag tcgccggtag actttaatcg cgtaggagtt       480
     cccgctctga agccggaggg ccatctcgcg gacgacagct cggacagcga cggggaggac       540
     gccgccggcg ggagttcact gtcacagagc ttcgagcatt tgaacatgtc gttgaagaca       600
     gacactgcat ctggccaagc aatgcctcta tcttcgccgc gcgggagcag tgctctcccc       660
     gccggccgcg actcccttgc gctcaagaaa ggcgcgagtc ccgaccgcgc gagcgaaggt       720
     tcattaagta gccgttccga ggacctactg gccgtggatc gcacagccgg tgagaataca       780
     aggctaaaga ccaccaattc aagtgacgat gataccgaca gcctccctga acttataacg       840
     agcgatgcca agttcagagc cgatggggct tccggccctg cccgtgtagt cagctcggga       900
     gtagagacgg ttatacacag ggcgatcgct cccgaggttg cgccaaggtt gcgtataact       960
     tccaagacag acttatctta tagatatgat acttcttctg aagatgacag tgaggcatac      1020
     agcggtatcg aggatgacta cctttcatat cagccatctc caaatatttc agatgcggca      1080
     acattccatg gacatagaag cagaacaggc agcccggcta gggcgcccca tccccttgtc      1140
     gagcaagagg aacatattga gctaccagtt atctctgacg acgacagcac gtcgaaatcg      1200
     tccgttcggg ataattatta cagcgaggaa agtgacaaca ctacatccca ggcactagtt      1260
     acgcaggata attcctcgca cgacactatt cacgacacta tccgtgaaag aagttttgat      1320
     aaaagcactt ctggatcggt aacacattcg ataccagtta ttaaagacga taatgaagat      1380
     tggcaaaacc agttaaggca gcaatcagta catctgggtg cttggaaccc tgataccgaa      1440
     ggcaaacggg gagcttttct aacacaagca tctccgatgt ctaccaacaa aggcatgtgc      1500
     ggttctcagg acgaagaaac gacaggcgat gaccaacagc ttgcagaacc ctgcaacgat      1560
     gattctgata gtgtttggga gggctttcca agcgtaggtg aatacgaaga tttacaatcg      1620
     gtcgccgaca ttaaaaccat ttatgacaac cagacattgt acaatgtacc tggaattata      1680
     acttcaagta ctagtgttcc acctcttcct agtagtatgt ccgagttgac tagtagacag      1740
     gatacgagta tcttgtcaga aagtacctcc ggaagtggat tggattccga ttccttgatg      1800
     agagttgttg aaggacaacg ccatgctcca aaaccatcga tgttcaagga aaactttggt      1860
     cagacaccag aagtccaagt tgaacatcta gttaatagcc cggtgccttc attggatatt      1920
     tgtgcgttga ttgaaggccc acagtcgcat tcttttaagc gagacaagct taacagccat      1980
     attgaggatc tcaacgctta cagcagtggg gcacagacct ggataaagta tgcgttaaaa      2040
     tctactcaat cctcttccaa tataactttt gatgagtatg tcatcagtaa gcatgtacaa      2100
     gatgcttatg cacaagctga ggaggtgagt aagaaacata gcgtgacaaa cgctgtaaac      2160
     cagaatgtct cacaattaag aaagaaggtg ttctctcata gcatgaaaga aggtgcaaaa      2220
     ggtctacttt catccatagg caaaaagaaa ctgtga                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page