(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE244

ASHGO_3.PE244        Location/Qualifiers
FT   CDS_pept        428007..430031
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774725"
FT                   /gene_name="KAR2"
FT                   /locus_tag="ACR038W"
FT                   /product="78 kDa glucose-regulated protein homolog "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAS51265.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00002527F1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C78"
FT                   /transl_table=1
FT                   /translation="MAFGKVSNWAVPLTALMYAMALVCLPMFAGGSRGLVYAADTDAEN
FT                   YGTVIGIDLGTTYSCVALMRNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAN
FT                   NPKNTIFDIKRLIGLKYNDKTVQREIKHLPFEVVDKNGMPAVAVTVKGERKLFTPEEIS
FT                   GMVLGKMKQIAEEYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNILRIVNEPTAA
FT                   AIAYGLDKTEDEHRIVVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGEDFDYKLVR
FT                   HFLKVFKKKHGVDVSSNAKAMAKLKREAEKAKRALSSQMSTRVEIDSFVDGIDFSETLT
FT                   RAKFEEMNLDLFKRTLKPVEKVLQDAGLKKEDIDDIVLVGGSTRIPKVQELLENFFNKK
FT                   ASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNPLTLGIEVTGGIMTPLIKRNTP
FT                   IPTKKSQIFSTAVDNQKTVMIQVYEGERAMAKDNNHLGKFELSGIPPAPRGIPQIEVTF
FT                   ALDANGILKVSATDKGTGKSESVTITNEKGRLSKDDIERMVAEAENYQKEDEEIRAKVE
FT                   ARHKLENYAHSLKNQVNGDLGDKLEEDDKETLLEAANDVLEWLEDNSDSATKEEFNEKF
FT                   ESLSQTAYPITSKLYGAGASDATDDEDDESDDYFDHDEL"
     atggcgtttg gcaaagtatc aaactgggcg gtgccgctga cggcgctgat gtatgcaatg        60
     gcgctagtgt gcttgccgat gtttgcaggc gggtcgcggg gattggtgta cgcggcagac       120
     acggacgcgg agaactatgg aacggtgatc ggtattgact tgggtacgac ctactcgtgt       180
     gtggcgctaa tgcggaacgg gaagacagag attcttgcga acgagcaggg gaaccggatc       240
     acgccgtcgt acgtggcctt cacggacgac gagcggctaa tcggtgacgc ggcgaagaac       300
     caggtggcaa acaaccccaa gaacacgatt ttcgacatca agcggttgat cgggttgaag       360
     tacaacgaca agactgtgca gcgtgagatc aagcacctgc catttgaggt ggtggacaag       420
     aacggcatgc ctgctgtggc agtgactgtc aagggcgagc gcaagttgtt caccccagag       480
     gagatctccg gtatggtgtt gggcaagatg aagcagattg cagaggaata cctcggcaag       540
     aaggtgaccc acgccgtcgt taccgtgcct gcgtacttca acgatgcgca gaggcaggcg       600
     acgaaggacg cgggtgccat cgcgggcttg aacatcttgc gtattgttaa cgagccaacc       660
     gcagctgcga ttgcatacgg gttggacaag accgaggacg agcaccggat tgtcgtctac       720
     gacttgggtg gtggtacctt cgatgtctcc ttgttgagca ttgaaaacgg tgtcttcgag       780
     gtccaggcaa ctgccggtga cacccacttg ggtggtgagg actttgacta caagttggtg       840
     cgccacttcc tcaaggtttt caagaagaag cacggcgtcg atgtttccag caacgcgaag       900
     gccatggcca agttgaagcg tgaggctgag aaggctaagc gtgcgctttc gagccagatg       960
     tccacccgtg tggagatcga ctcttttgtg gacggtattg atttctctga gaccttgacc      1020
     agagccaagt ttgaggaaat gaaccttgac ctattcaaga ggactttgaa gcctgttgag      1080
     aaggtcttgc aggatgctgg tttgaagaag gaggacattg atgacattgt tcttgtcggt      1140
     ggttccacca gaatccctaa ggtgcaagag ttgttggaga actttttcaa caagaaggcg      1200
     tccaagggca ttaacccaga tgaggctgtt gcatacggtg cagctgtcca agctggtgtt      1260
     ttgtctggcg aggaaggtgt tgaggacatt gttttgctag atgttaaccc tctaaccttg      1320
     ggtattgaag ttaccggtgg tatcatgact cctttgatca agagaaacac ccctatccca      1380
     accaagaagt cccagatttt ctccaccgca gtcgacaacc agaagactgt gatgatccaa      1440
     gtctacgagg gtgagagagc tatggccaag gacaacaacc acttgggtaa gtttgaacta      1500
     agtggtatcc caccagcccc aagaggtatt ccacagatcg aggtcacttt tgctcttgac      1560
     gccaacggaa ttttgaaggt ttctgccact gacaagggca ctggtaagtc tgagtctgtc      1620
     actataacga acgaaaaagg tagattgtcc aaggatgaca tcgagagaat ggtcgccgag      1680
     gctgagaact accagaagga ggacgaagag atcagggcga aggtcgaggc tcgtcataaa      1740
     ttggagaact acgcccactc gttgaagaac caggtcaacg gcgacctagg tgacaagcta      1800
     gaggaggatg acaaggagac cttattggag gctgcgaatg acgttcttga atggctagag      1860
     gataattcag actcagctac caaggaagaa tttaacgaga agttcgagtc tttgtctcaa      1920
     actgcttatc caattacttc taagctttac ggtgcaggcg ctagcgatgc tactgatgac      1980
     gaggatgacg agtctgatga ctactttgac cacgacgaat tgtga                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page