(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE251

ASHGO_3.PE251        Location/Qualifiers
FT   CDS_pept        439721..441412
FT                   /codon_start=1
FT                   /gene_family="HOG000226734" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078982"
FT                   /locus_tag="AGOS_ACR045W"
FT                   /product="ACR045Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51272.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001DB2814"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C71"
FT                   /transl_table=1
FT                   /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQIQKSIAAIREIHQMCLTS
FT                   MGPCGRNKIIVNHLGKYLITNDAATMLRELEIVHPAVKVLVMATEQQKIDVGDGTNMVM
FT                   VLAGELLNLSEKLISLGLSPVEVIQGYTMAKNFTIEELDKMVVQEVIDKHDKDELIKVI
FT                   KPVISSKQFGSEELLSELIAEAVSYVLPSKSNFFNVDSIRVVKIMGSSLSNSTVIKGMV
FT                   FNREPEGHLKSLPKGGKHKVAVFTCPIDIASTETKGTVLLHNAQEMLDFTKGEEKQLDA
FT                   MIKEIADTGVRCVIAGSGVGELALHYLNRYEVLVLKIPSKFELRRVCRVCGATPMPRLG
FT                   APTPEEIGVVETVKSMEIGGDRVTVFKQESEETTRTATIILRGATQNNLDDIERAIDGG
FT                   VAAIKGLLKLDGGKLLPGAGATEIELVSRITKYGEKTPGLLQLAIKQFAMAFEVIPRTL
FT                   AETAGLNVNEVLPNLHAAHAPAGDSASTDDKIYQGIDIDGTTPEGIVDIRNEGVYDMLA
FT                   AKKFAINVATDAANTVLSVDQIIMAKRAGGPAAPKGPKPGNWDQED"
     atgtctctga agctacctca aaatccgaat gccggcctct tcaagcaagg gtataacagt        60
     tactcgaatg cagacggtca aattcaaaag tccattgcgg cgattcgcga aatccatcag       120
     atgtgtttga cttcgatggg gccttgtggc aggaataaga tcattgtaaa ccatctgggg       180
     aagtacctga tcaccaatga tgccgcgacg atgctacgtg agctggagat cgttcatccg       240
     gccgtaaagg tgcttgtgat ggccaccgag cagcaaaaaa tagacgtcgg ggacggcact       300
     aacatggtca tggtactagc aggagagctg ttgaacctca gtgaaaagtt gatttctctg       360
     gggctgtctc ctgtggaggt tattcagggc tacacaatgg ctaagaactt cactattgag       420
     gagttggata agatggtggt ccaagaggtc atcgacaagc acgataagga cgagcttatt       480
     aaagtgataa aacctgtgat atcttccaag cagttcggtt ccgaagagct actcagcgag       540
     ctcatcgcag aagcagtaag ctatgttttg ccgtccaaat ccaatttttt caacgtggat       600
     tcgatcaggg ttgtgaagat tatgggaagc tccttgtcca actccactgt tatcaagggt       660
     atggttttca accgtgagcc agaaggccac ttgaagtctc tgccaaaggg tgggaagcac       720
     aaggtggctg tgttcacttg ccccattgac attgccagca cagaaacaaa gggtacggtc       780
     ttgctacaca atgcgcagga aatgttggac ttcaccaagg gtgaggagaa gcagctggat       840
     gcaatgatca aagaaattgc agacactggc gtgcgctgtg tgattgcagg cagtggcgtc       900
     ggtgaattgg ctctgcatta tctgaacaga tatgaagtcc tcgtcctgaa gatcccctct       960
     aagtttgagt tgagaagggt atgccgcgtg tgcggtgcta cgccaatgcc acggctgggc      1020
     gcccctactc cagaggaaat cggtgtagta gagactgtta agagcatgga aattggtggc      1080
     gacagagtta ccgtatttaa gcaagagtcg gaggaaacga cgagaactgc cacgattatt      1140
     ctacggggcg ccacacagaa taacttggac gacatagaaa gagccatcga tggtggagtt      1200
     gccgccatca agggcctcct caagctcgat ggcgggaagc tgctgccggg agcaggtgcc      1260
     acagagatcg agctcgtgtc taggattacc aaatatggag agaagacccc tggtttgcta      1320
     cagttggcga tcaaacagtt tgcgatggca ttcgaggtca tccccaggac gttggcggaa      1380
     actgccggcc tgaatgtcaa cgaagttcta ccaaaccttc atgccgcgca tgcacctgct      1440
     ggcgacagcg caagcactga cgacaagata taccagggca ttgatataga cggcaccaca      1500
     ccagagggta ttgtagatat caggaatgaa ggcgtttacg acatgctggc tgccaagaaa      1560
     ttcgcaatca acgtcgcaac cgatgctgct aacactgttc tctctgttga tcagatcatc      1620
     atggcgaaga gagcaggcgg ccctgcagct ccaaagggac caaaaccagg taactgggat      1680
     caagaagatt ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page