(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE276

ASHGO_3.PE276        Location/Qualifiers
FT   CDS_pept        487566..488642
FT                   /codon_start=1
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927745"
FT                   /locus_tag="AGOS_ACR070W"
FT                   /product="ACR070Wp"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine metabolic process "
FT                   /protein_id="AAS51296.2"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006566"
FT                   /db_xref="HOGENOM:HBG123215"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB282E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C47"
FT                   /transl_table=1
FT                   /translation="MQRKFKIKVPASSANIGPGYDVLGIGLGLFLELSVSINSEQAQLT
FT                   NADPNNCHLEYTEDSEGYASVPLRSDENLITRTALYLLRCNNIRSFPAGTQIVVHNPIP
FT                   LGRGLGSSGAAVVAGALLGNEIGQLGFSKQRVLDFCLMIERHPDNITAALMGGFCGSFL
FT                   RDLTPAELERREIPLAEVLPGPRASGGEDTGMSPPEPPFNIGQHVKYNWNPAVKCLVVI
FT                   PNFELSTATSREVLPQAYTTKDLVFNLQRLAVLTTALSQNPPNPELIYPAMQDRVHQPY
FT                   RKTLIPGLSEILSSVTPTTHPGLLGICLSGAGPTILALATGNFEDIAGEIVARFSKWNV
FT                   TCTWKLLDIAEQGSAVEA"
     atgcagcgca agtttaagat aaaggttcca gcatcgtcgg ccaatattgg gccgggctac        60
     gacgtgctgg gcatcgggct ggggctgttc ctggagctgt ctgtcagcat taactcggag       120
     caggcgcaac tgaccaacgc agaccccaac aattgccacc tggagtacac ggaggacagc       180
     gaagggtacg catctgtgcc gctgcgctcg gacgaaaacc taattacccg cacagcgctt       240
     tacctgctgc gctgcaacaa catccgcagc tttcctgctg gcacgcagat cgtggtgcat       300
     aacccaatcc cgctgggccg cgggctgggg tcttccgggg ctgccgtcgt ggccggcgcg       360
     cttctcggga acgagattgg gcagctgggg ttctctaagc aacgtgtgct cgacttttgt       420
     ctaatgatcg agcggcaccc ggacaacatc acggctgccc tgatgggtgg cttctgcggc       480
     tcgttcctgc gcgacctgac gcctgccgaa ctagagcggc gcgaaattcc tcttgctgag       540
     gttctgccgg gcccgcgtgc gagcggcggc gaggacaccg gcatgtcgcc gccggagcca       600
     ccgttcaaca ttggccagca tgtcaagtac aactggaacc ctgcagtcaa gtgcctcgtt       660
     gttattccaa actttgagct gtcgacggca acctctagag aggttcttcc ccaggcatac       720
     accacgaagg accttgtttt caacctgcag cgtctggccg tgctgacgac tgcgttgtcg       780
     cagaatccgc cgaacccgga attgatctac cctgctatgc aggacagggt ccaccagccc       840
     taccgcaaga ctctcattcc tggtttgtcc gagatcttga gtagcgtgac gcccaccacc       900
     cacccgggcc tgctgggcat ctgcttgtcg ggagcgggtc caaccatcct ggctttggct       960
     acgggaaact tcgaggatat tgcgggagag attgtcgcgc gcttctccaa gtggaacgtg      1020
     acgtgcacct ggaagctctt ggacatcgct gagcagggtt ctgccgtcga agcctaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page