(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE277

ASHGO_3.PE277        Location/Qualifiers
FT   CDS_pept        488919..489554
FT                   /codon_start=1
FT                   /gene_family="HOG000056522" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748969"
FT                   /locus_tag="ACR071W"
FT                   /orf_name="AGOS_ACR071W"
FT                   /product="ACR071Wp"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="AAS51297.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniParc:UPI0000252811"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C46"
FT                   /transl_table=1
FT                   /translation="MSSKGYKKPSLYGYAKIYIYSFLTLIVGSYGLYKLLTNHGEDINI
FT                   GKFLSRTSPYMWANLGISLCIGLSVVGAAWGIFITGASIIGAGVRAPRITTKNLISIIF
FT                   CEVVAIYGLIMAIVFSSKLTVATPETLFSKSNLYTGYSLFWAGITVGVSNMICGIAVGI
FT                   TGATAAVSDAANSALFVKILVIEIFGSVLGLLGLIVGLLMAGKTVEFQ"
     atgtcatcta aaggctacaa aaagccatct ttatatgggt acgccaaaat atacatttat        60
     agcttcctta cgctgatagt tggaagctac gggctttaca agctcctaac gaaccatggt       120
     gaagacatta acatcggaaa attcttgagc cgcacgtcgc cctatatgtg ggccaaccta       180
     ggtatctcat tgtgcatagg cctgtcagtg gttggagctg catgggggat ttttattact       240
     ggtgcgtcga ttatcggggc tggcgttcgc gcaccacgca tcacaacaaa gaacttaatc       300
     tccatcattt tctgcgaggt ggtcgccatt tatggattga tcatggcgat tgtgttctcc       360
     tcgaaactca ccgtcgcaac accagagacc ctattttcga agtcgaactt gtatacgggg       420
     tactccttgt tctgggctgg gattacagtc ggtgtctcca acatgatctg tggtattgca       480
     gtcggcataa ccggtgctac tgcagccgtt tcggatgctg caaactcggc cttgtttgtg       540
     aagatattgg tgattgagat ttttgggtcg gtcttagggt tgttgggttt gatcgtgggc       600
     ctattgatgg cgggcaaaac agtcgaattc caataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page