(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE278

ASHGO_3.PE278        Location/Qualifiers
FT   CDS_pept        complement(489698..492670)
FT                   /codon_start=1
FT                   /gene_family="HOG000176022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078984"
FT                   /locus_tag="ACR072C"
FT                   /orf_name="AGOS_ACR072C"
FT                   /product="ACR072Cp"
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="AAS51298.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG020916"
FT                   /db_xref="HOGENOM:HBG314403"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="UniParc:UPI0000252812"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C45"
FT                   /transl_table=1
FT                   /translation="MVDDIRNNEDKQIGSASGLQTPSAKKGKTKDQKQEEELSEDDLRL
FT                   KADLETLVQRLLESDASLCEQSLAQLKEFIKNSTSSMTAVPAPLKFLRPSYPDLCAVYD
FT                   KWVDPKLKSLLADVLSVLSMTYSDEGKHDSLRFRLLSNEKDIESWGHEYIRHLALEVGD
FT                   VYNEQVENESDETYDQESKRAISDAEFPKDVLVQLALDIVPYFLKHNGEADAVDLLLEV
FT                   ESIDKLPQFIDENTFQRVCQYMVSCVPLLPPPEDVTFLQTAFSLYLSENQLTEALALAI
FT                   RLGEESLIRSVFDATTDPVMHKQLAYILAAQKSSFEYSAVQDIIGSTKLSEHFLYLAKE
FT                   LNLTVPKFPEDIYKSHLDNSVRSAFASSGLDSAQQNLAASFVNGWLNLGYCADKMCLDD
FT                   DNWVYKTKGDGMTSTVASIGSIYQWNLDGLQHLDKYLYADDVEVKAGALLGIGVSACGV
FT                   HDGDVEPALLLLQDYVTNPNAKLSSAAILGLGIAFAGSRNDELLSLLLPIAADTSLSIE
FT                   TSAMASLALAHAFVGTCNGDITTSIMDNLLERSSIELKTEWTRFLTLALGILYMGQGDQ
FT                   VEDVLETISAIEHPITSAIEVLVNVCAYTGTGDVLLIQDLLYRLTPKKEEEEEDDDENE
FT                   DGENDEDGDDAEGERDGSGQNIPEDIDSLVQEVMNTASTTEDSAISNEESTSTSKKADE
FT                   DKMDVDNSKEEDAKNGDQGKHESKDDESSEKSMAHIDELTYSVLGIAMVAMGEDIGKEM
FT                   SLRHFGHLMHYGNQHIRRVVPLAMGLVSVSDPQMKVFDTLSRFSHDPDLDVSINSIFAM
FT                   GLCGCGTNNARLAQLLRQLASYYSKEQNTLFVTRLAQGLVHLGKGTMTLDVFNDAQVLN
FT                   KVTLASLLTVLIGLTSPTFMLKHHQLFYYLNSGIRPKFILTLNEEGEPIKVNVRVGQAV
FT                   DTVGQAGKPKTITGWITQSTPVLLNHGERAELETNEYISYASRIEGVVILKKNPNYKEE
FT                   E"
     atggtggacg atattaggaa caacgaggac aaacaaatcg gttcggcaag cggtctgcaa        60
     acaccctcgg ccaagaaagg gaagaccaag gaccaaaagc aggaggaaga actatctgag       120
     gatgacttaa ggctgaaggc agacctggag acacttgtac agaggctatt ggagtcagac       180
     gcgtcgctct gcgaacagag cctggcgcag ctgaaggagt ttatcaagaa ctcgaccagt       240
     tctatgacgg ccgttcccgc gccactcaag tttctgcgcc cttcataccc ggacctgtgt       300
     gcagtgtacg acaagtgggt ggatccgaag ctgaagtcgc tgcttgccga cgtgctgtcc       360
     gtgttgagca tgacgtactc ggatgagggc aagcatgact ctctgcggtt ccgtctgcta       420
     tcgaacgaga aggacatcga gagctggggg cacgagtaca tccgccactt ggcgctggag       480
     gtgggcgatg tctacaacga gcaggttgag aacgagtcgg atgaaacata cgaccaagaa       540
     tcaaagcgtg ctatctctga cgcagagttc ccaaaggatg ttctagttca gctggcgtta       600
     gatattgtgc cctacttctt gaagcacaat ggcgaggccg atgctgttga tttgctcctt       660
     gaagttgaat ctatcgataa gttaccacag ttcattgacg agaatacctt ccagcgggtc       720
     tgccagtata tggtatcgtg tgtcccactg ttacctcccc cagaggatgt taccttcttg       780
     cagacggcat tttctttgta tctatcagag aaccagctta ctgaggcgct ggccctcgca       840
     atcagactag gcgaggaatc tctcattcgc tccgtctttg acgcgaccac tgatccagtc       900
     atgcacaagc aactagctta tattttggcg gctcaaaagt catcttttga gtattcagcg       960
     gttcaagata tcatcggaag tacgaagttg agcgagcact ttttgtacct ggccaaggag      1020
     ctaaacttga ctgttcccaa gtttccggag gatatataca aaagtcactt ggacaactcg      1080
     gtcagaagtg cgtttgcaag ctctgggcta gactctgctc agcagaacct ggctgcctca      1140
     tttgtgaacg ggtggctaaa cctaggttac tgtgcggata aaatgtgcct cgacgacgat      1200
     aactgggtgt acaaaaccaa gggcgatggt atgacgtcta ccgtggcaag cattggctct      1260
     atttaccagt ggaatctgga tgggctccag catttagaca agtacttgta tgcggatgat      1320
     gttgaagtga aagccggcgc gctgctaggt attggtgtat ctgcatgcgg ggttcatgac      1380
     ggagacgttg aaccagcctt gctgttatta caagattatg tcaccaaccc aaatgctaaa      1440
     ttgagcagcg ctgcaatttt gggcttgggt attgcatttg caggaagcag aaatgatgag      1500
     cttctaagtt tgttgctgcc gatagccgct gatacgtcgt tgtcgattga gacttctgct      1560
     atggcgtcgt tggccttggc gcacgccttt gttggaacat gtaatggtga tattaccacc      1620
     tctatcatgg acaatcttct agaaaggtct tcaattgaat tgaaaactga gtggactagg      1680
     tttttgacat tggctctcgg tatactatac atgggacagg gtgatcaagt tgaggatgtg      1740
     ctagagacca tatctgccat agaacaccca atcacttcgg ctattgaggt tttggtaaac      1800
     gtctgcgcat acactggcac aggggacgtt ctgttaatcc aagacctgtt gtatcgtcta      1860
     actccgaaga aggaggaaga ggaggaggac gatgacgaga atgaagacgg tgaaaacgat      1920
     gaggacggag atgatgctga aggcgaaaga gatggcagcg gtcaaaatat acccgaggac      1980
     attgattccc ttgttcagga agtcatgaat accgctagca ccaccgaaga ctcagcaatt      2040
     tctaacgaag agtcgacatc aacttcaaaa aaggcagatg aggataaaat ggatgtggac      2100
     aactccaagg aagaagatgc taaaaatggc gaccaaggaa agcacgagtc caaggatgat      2160
     gaaagtagtg aaaagtccat ggcacacatt gacgaactaa cttactctgt ccttggtatt      2220
     gctatggttg caatgggcga agatattggc aaggagatgt ctctccgtca ttttggccat      2280
     ttgatgcact atggtaacca gcatatccgt cgtgtcgttc cgctagctat ggggttagtt      2340
     agcgtttcag acccgcagat gaaggtgttc gacacgctat cacggttttc ccatgaccct      2400
     gacttagacg tttcgattaa ctccattttt gcaatgggct tgtgcggatg cggtactaat      2460
     aatgcgagat tggctcaact gctgagacaa ctagccagct actactctaa agaacaaaac      2520
     actttgtttg tgactagact ggcacaaggt cttgtacacc tagggaaagg tacaatgact      2580
     ttagacgtct tcaatgatgc ccaggttctc aacaaggtaa cgttggcatc ccttttgaca      2640
     gttttgattg gtttaacgag cccaacgttt atgctaaaac atcaccagtt gttttactac      2700
     ctaaacagtg gtatcagacc aaagttcatt ctaactctaa acgaggaggg agaacctata      2760
     aaggtaaatg tgcgggtcgg ccaagccgtc gatacagtcg gtcaggccgg taagccaaag      2820
     accattaccg gttggattac ccagtctact cccgttttac taaaccatgg cgagcgggcc      2880
     gaacttgaga caaacgaata tatcagctat gctagtagaa ttgagggtgt ggtgatcctg      2940
     aagaagaacc ccaactacaa ggaggaggag tag                                   2973
//

If you have problems or comments...

PBIL Back to PBIL home page