(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE280

ASHGO_3.PE280        Location/Qualifiers
FT   CDS_pept        496155..497387
FT                   /codon_start=1
FT                   /gene_family="HOG000192515" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748970"
FT                   /gene_name="SNX4"
FT                   /gene_synonym="ATG24"
FT                   /locus_tag="ACR074W"
FT                   /product="Sorting nexin-4"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="autophagy"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS51300.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058403"
FT                   /db_xref="HOGENOM:HBG202212"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0000252814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C43"
FT                   /transl_table=1
FT                   /translation="MSEIKLGDQWFIIVSDPQKQRGDKSSSGSYVTYQISSKPATEGDK
FT                   RSGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVLNYLDRFSQSFTQKRCHS
FT                   LQNFLQRLAQHPVLSQSKILHTFLVSSDWDAYQKSLAETVGNLSNKEELTETIMNAFKS
FT                   VHSQSDEFVEIKEKSGKLDHNVSKIDKLFHRVVKKQEAIAEDYGKLGLSLRELQELVTT
FT                   GDDRNSEVGNLGTKIKTFNEGMAQLSYSLRDLSRYIDYEYIIDLRDMEDYIDSMKQLIK
FT                   LKDQKQIDYEELSDYLTRSINEKNNLISGYGSGSNFFKSKLEEFTGINQEAARREKISK
FT                   LESKVQALTTEVENAKKVADAFEKEALKEVEIFEQIKTRELKRSLTTLADHHIEFYQKM
FT                   VNTWSKIEESL"
     atgtctgaga ttaagcttgg agaccaatgg ttcatcatcg tgtctgaccc gcagaagcaa        60
     cgaggggaca agagctcttc tgggtcgtac gtaacatacc aaatatcgtc gaagcctgcg       120
     acggagggcg ataagcgcag cggcgaggac gacataacgg tagtgcaccg gcgctacagc       180
     gactttgtgc ttctgtacca gattctggca aatgactacc ctgcatgtat cgtgccaccg       240
     ctaccggaca aaaaagtgct caactacctg gaccggttca gccagtcgtt cacgcagaag       300
     cggtgccaca gcctgcagaa cttcctgcag cggctggcgc agcaccctgt gctgtcgcag       360
     tcgaagatcc tgcatacgtt tctggtcagc tccgactggg atgcgtacca aaagagcctt       420
     gcggagacgg tcggcaacct gagcaacaag gaggagctga cggagacgat catgaacgca       480
     ttcaagtccg tgcacagcca gagcgacgag tttgtggaga tcaaggagaa gagcggcaag       540
     ctggaccaca acgtgtcgaa gatcgacaag ctgttccacc gggtggtgaa gaaacaggag       600
     gccatcgctg aggactacgg caagctgggg ctgagtctgc gcgagctaca ggagctggtc       660
     acgaccggcg acgacaggaa cagcgaggtg gggaatctgg ggacgaaaat caagacgttc       720
     aacgagggga tggcgcagct gtcatacagc ctgcgcgacc tgagtcgcta catcgactac       780
     gaatacatca tcgacttgcg agacatggag gactacatcg actcgatgaa acagctgatc       840
     aagctgaagg accagaaaca gatcgactac gaagagctca gcgactacct cacgcgatcg       900
     atcaacgaga agaacaacct tatttcgggg tatgggtccg gaagcaactt ctttaagagc       960
     aagctcgagg agttcacggg gatcaaccag gaggccgcta ggagggaaaa gatttccaag      1020
     ctggagtcga aggtccaggc gctgacgaca gaggttgaga acgccaagaa ggtggccgac      1080
     gccttcgaaa aggaggcgct caaggaggtg gagatcttcg agcaaataaa aacacgcgag      1140
     ctgaagcgct ccctcaccac gttggccgac caccacatcg agttctacca gaagatggtc      1200
     aatacatggt ccaagataga agagagcctg tag                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page