(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE284

ASHGO_3.PE284        Location/Qualifiers
FT   CDS_pept        join(501162..501168,501253..502646)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622173"
FT                   /gene_name="DBP5"
FT                   /locus_tag="ACR078W"
FT                   /product="ATP-dependent RNA helicase DBP5 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS51304.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2831"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C39"
FT                   /transl_table=1
FT                   /translation="MSGNAQKPDASEMLADLDLNKKTKETTLEAGSAESAPSAPAENQA
FT                   KSDSNLINSEYEVKVRLADIQADPNSPLYSVKSFEELGLAPELLKGLYAMKFQKPSKIQ
FT                   ERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRVDVAVPATQAICLAPSRELARQT
FT                   LEVIQEMGKFTKIASQLIVPDSYEKNKAINAHIIVGTPGTVLDLMRRKMIQLGKVKTFV
FT                   LDEADNMLDKQGLGDQCIRVKKFLPKDTQLVLFSATFDDSVREYARRVVPNANSLELQR
FT                   NEVNVSAIKQLFMDCNDERHKFTVLCDLYGLLTIGSSIIFVQTKQTANMLYTELKREGH
FT                   QVSILHGDLQSADRDRLIGDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPMTANGQ
FT                   PDPSTYVHRIGRTGRFGRTGVAISFIHDKKSYETLAAIQSYFGDIQITKVPTDDMDEME
FT                   KIVKKVLK"
     atgtcaggaa atgctcagaa gcccgatgcg tccgagatgc tagcagactt ggatttgaac        60
     aagaagacga aggaaactac gctcgaggcg ggttccgccg agagtgcgcc atcggcgcct       120
     gcggaaaatc aggcaaagtc cgattcgaac ctcatcaact cagaatacga ggtcaaggtg       180
     cgcttggcag acatccaggc ggacccaaac tcaccgctat acagtgtgaa gtcctttgag       240
     gagcttgggc ttgcaccgga gttgctgaag ggtctttacg caatgaagtt ccagaagccg       300
     tctaaaattc aggaacgcgc actaccgctg ctgttgcaca acccccccag aaacatgatc       360
     gcgcagtccc aatccgggac ggggaagacc gctgcctttt cgctcacaat gctgtcccgc       420
     gtggacgttg cggttcctgc cacgcaggcc atctgtctgg cgccgtcgcg cgagctcgcg       480
     cgccaaacgc tggaggtgat ccaggagatg ggcaagttta ccaagattgc atcgcagctc       540
     atagtccccg actcatacga gaagaacaag gcgatcaacg cccacattat cgtcggcacc       600
     cccggcacgg tgctcgacct catgcgcaga aagatgatcc agctgggcaa ggtcaagacg       660
     ttcgttctgg acgaggctga caatatgctt gacaagcagg gcctgggaga ccagtgcatc       720
     cgggtcaaga agttcctacc gaaggacacc cagctggtgc tgttttccgc cacgttcgac       780
     gacagtgtcc gcgagtacgc gcgcagggtg gtgcccaacg caaactcgct cgagctacag       840
     agaaacgagg tcaacgtcag cgcaatcaag cagctcttca tggactgcaa cgacgagcgc       900
     cacaagttca ccgtgctctg cgacctgtac ggcttgctca caatcgggtc ctcgatcatt       960
     ttcgtccaga caaagcaaac agcaaacatg ctctacacgg agctcaagcg cgaggggcat      1020
     caggtctcca tcctgcacgg cgatctgcag agcgccgaca gagaccgcct catcggcgac      1080
     ttccgtgagg gccgctcgaa ggtgctcatc accaccaacg tccttgcgcg cggcatcgac      1140
     atcccaacgg tctccatggt cgtcaactat gatctgccga tgaccgcaaa cggccagccc      1200
     gatccatcta cctatgttca ccggattggt cggaccggcc gcttcggcag aaccggcgtc      1260
     gcaatctcct tcatccacga caagaagtcc tacgagacgc tcgccgccat ccagagctac      1320
     ttcggcgata tccagatcac caaggtgccc acggacgaca tggacgagat ggagaagata      1380
     gtcaagaagg tgctcaagta g                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page