(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE300

ASHGO_3.PE300        Location/Qualifiers
FT   CDS_pept        complement(523827..524756)
FT                   /codon_start=1
FT                   /gene_family="HOG000188957" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748979"
FT                   /locus_tag="ACR094C"
FT                   /orf_name="AGOS_ACR094C"
FT                   /product="ACR094Cp"
FT                   /function="protein prenyltransferase activity"
FT                   /protein_id="AAS51320.1"
FT                   /db_xref="GO:0008318"
FT                   /db_xref="HOGENOM:HBG058411"
FT                   /db_xref="HOGENOM:HBG623262"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniParc:UPI0000252828"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C23"
FT                   /transl_table=1
FT                   /translation="MEAYNYEDLEPVSLELGAEGEICQIMYSPEYARVIGLLRALMAAD
FT                   EVSARALALNSTALRMAPSDYTTWNHRYRLVKALYGADAAKLNAELDWLDEFTLGNLKN
FT                   YQIWSYRQALLRLHPEPKLPRELPVLHMMLQEDAKNYHVWSYRKWAVLFFGDFRHELEY
FT                   AAWMIEGDVYNNSAWAHRMFVLKSTTPSASDIQREVDYACANIELVPQNSSSWNYLRGL
FT                   YDQFRGGRYDEDVVDFALSFTGDLLDSESEGNALPEIRSSHALELLAHVYSQEKATHDK
FT                   ARRAYKGLASAYDPIRRPFWELQLSKLV"
     atggaggcgt acaactacga ggacctggag cccgtcagcc tcgagctggg cgccgagggc        60
     gagatatgcc agatcatgta cagtcccgag tacgcgcgcg tgattgggct gctgcgcgca       120
     ctgatggcgg cggacgaggt gtctgcgcgg gcgctggccc taaacagcac ggcgctgcgg       180
     atggcgccgt cggactacac gacgtggaac caccgctacc ggctggtgaa ggcgctgtac       240
     ggcgcggacg ccgcaaagct gaatgcggag ctcgactggc tggacgagtt cacgctggga       300
     aacctgaaga actaccagat ctggtcgtac cggcaggcgc tgctgcggct gcaccctgag       360
     ccgaagctgc cgcgtgagct gccggtgctg cacatgatgc tgcaggagga cgcgaagaac       420
     taccacgtgt ggtcgtaccg caagtgggcg gtgctgttct tcggcgattt caggcacgag       480
     ctggagtacg cggcctggat gatcgaaggc gacgtctaca acaacagcgc gtgggcgcac       540
     cgaatgtttg tgcttaagag caccacgccc tcggccagcg acatccagcg cgaggtcgac       600
     tacgcgtgcg ccaacattga gctcgtgccg caaaattcga gcagctggaa ctacctccga       660
     ggcttgtacg accagttccg cggggggcgc tacgacgagg acgttgtaga cttcgctctc       720
     tcttttacgg gcgacttgct ggactcggaa tctgagggca acgccctgcc cgaaatccgc       780
     tcgtcccacg cactcgaact gctggcgcac gtctactccc aggagaaggc cacccacgac       840
     aaagcaaggc gtgcgtacaa gggcttggcg tccgcgtacg atcctataag acgccccttc       900
     tgggagctac agctgtctaa gcttgtgtaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page