(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE313

ASHGO_3.PE313        Location/Qualifiers
FT   CDS_pept        544400..545554
FT                   /codon_start=1
FT                   /gene_family="HOG000164620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622175"
FT                   /locus_tag="AGOS_ACR107W"
FT                   /product="ACR107Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51333.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058418"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2848"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C10"
FT                   /transl_table=1
FT                   /translation="MSTENVQTDYASTKKRKKVVKACVFCRRSHMICDDRRPCSRCIKR
FT                   DIGHLCCDEKLQPGAERLQSQSPLRTETFDVQPVPEHLVAGLGVGAAGGNRYANVINHP
FT                   KFVSEHIGSEFSSLNEFLTLLEDPLLMEATPSPGCNGQAADPGARGPGELVGGVLAGAA
FT                   PQEQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDK
FT                   YMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPAC
FT                   LWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQK
FT                   AVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICIIGNFIPIS"
     atgtcgacag agaatgtgca gacggactat gcgtccacta agaaacgcaa gaaggtggtc        60
     aaggcctgcg tgttctgcag gcgatcgcac atgatatgtg atgatcgaag gccgtgctcg       120
     agatgcataa agagggacat cgggcacctc tgctgtgacg agaagctgca gcccggcgcc       180
     gagcggctgc agtcgcagtc gccgctgcga accgagacgt tcgacgtgca gccggtaccg       240
     gagcacctgg tggccgggct gggcgtcggg gctgcaggcg ggaaccggta cgccaacgtg       300
     atcaaccacc cgaagtttgt gagcgagcac atcgggtcgg aattctcgtc gctgaacgag       360
     ttcctgacgc tgctggagga cccgctgctg atggaggcga cgccgtcgcc gggctgcaac       420
     gggcaggcgg cggatcccgg ggcgcgggga ccgggggagc tggtaggcgg cgtgctggcc       480
     ggcgctgcgc cgcaggagca gccgacggcc aaggagaact tcttcctgac ggccgcggac       540
     ccctcgacgg aggtggagcc ggaggaccgc ctgaagctcg tgatcaacgc gaagctggag       600
     gcgggcctgc tgcagcctta caactactcg caggggtacg cgcgcctgca gaactacatg       660
     gacaagtaca tgaaccagtc gtcgcggcag cgcatcctga agccgctctc gacgatccgg       720
     ccggcgttcc gcgcgatcgc gcgctcgctc aaggacgtgg acctggtgct cgtggaggag       780
     gggttcgagc gcatgctgct gtcctacgat agagtattta cgtccatgtc catgccggcg       840
     tgtctgtggc ggcggacggg cgagatctac cgcggcaaca aggagtttgc gtcgctggtg       900
     gactgcaccg ttgacgatct gcgcgatggc aacctcgcga tatatgagct gatgacagag       960
     gagagtgcgg tcaatttctg ggagaagtac ggctcgatcg cctttgacaa gggccagaag      1020
     gcagtgctga cgagctgcaa cctgagaagt aaggacggaa ggaagcgcag gccgtgttgt      1080
     ttcagtttta cgatccggcg ggaccgctac aatattccca tatgtattat aggcaacttt      1140
     atacccatct cctaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page