(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE323

ASHGO_3.PE323        Location/Qualifiers
FT   CDS_pept        557735..559309
FT                   /codon_start=1
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748991"
FT                   /locus_tag="ACR117W"
FT                   /orf_name="AGOS_ACR117W"
FT                   /product="ACR117Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51343.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025283F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C02"
FT                   /transl_table=1
FT                   /translation="MAFMFKPPEQRKRNEKSPRLSLPSTLIGSATPAGDEHASGAMGNS
FT                   IGSDLHREQKLRGLGQSVQIAEQLSAGSTDTAGSDVLSQHAPSSASSQTSKVLPRRPVP
FT                   PGMPALAFLSKHPYAQQVTGPLPTTSGEKAGSHSGATTLSAGPTRPPLPKLPYLHVEPK
FT                   LPCEELPYSALHAGSSSSSNIHSPSRALQEMRLISAGSTPVEPVPPAATVPPCKDVDEL
FT                   EEEMWTHVHLKDQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQESQKQIF
FT                   RELQFNKSCKSDYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKV
FT                   LGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSLATTFTG
FT                   TSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPFDSGKFAANMPPIELLMLILTF
FT                   TPQLKDEPEANIVWSKAFKSFISYCLKKESRERPSPRQMLRHPWIQGQMKKRVNMEKFI
FT                   YKCWQAR"
     atggcgttca tgttcaagcc accagagcag cggaagcgca atgagaagtc tccgagattg        60
     tcgctgccgt cgacgttaat tggtagtgct acccctgcgg gcgacgaaca cgcatcagga       120
     gcgatgggca actcaattgg gtcggatcta cacagggagc agaaactgcg tggacttggg       180
     caatctgtac agatagcaga acagctatct gctggatcta cggatactgc ggggtcggac       240
     gttctctcgc agcacgcgcc atctagcgca tcgtcgcaga cctcgaaggt ccttccccgg       300
     cggcctgtgc cgccggggat gcctgcgctg gcgtttctgt cgaagcaccc gtacgcacag       360
     caggtgacgg ggccgctgcc cacgacgagc ggagagaagg cgggaagtca ctcaggtgca       420
     accacgctgt ccgcggggcc aaccaggcct ccgctgccca agttgccgta cctgcacgtg       480
     gagccgaagc tgccctgcga ggagctgccg tactctgcgc tgcacgcggg ctcgagctca       540
     tccagcaaca tacattcccc gtcgcgcgca ttgcaggaga tgcggttaat ctctgctggc       600
     agtactccgg ttgagccggt gcccccggcg gcgactgtac cgccatgcaa agacgtggac       660
     gaattggagg aagagatgtg gacgcatgtg cacctgaaag accagataga agagcttggc       720
     gtgctgggcg agggcgcggg cggatcagtc acgaagtgca aacttaggca cggttccaaa       780
     atcttcgcgc tcaaaactat aaccacgctg accacggacc aggagagcca gaagcagata       840
     ttccgcgagc tgcagttcaa caagagctgc aagtctgact acatcgtgcg ctactacggc       900
     atgtttaccg acgaggagca ctcctcgata tacatcgcca tggaatacat gggcgggagg       960
     tcgctggacg ccatctacaa acacctacta aaacacggcg gcagggtcgg cgagaaggtg      1020
     ctcggcaaga tcgccgaaag cgtgctgcgc ggcctgtcgt acctccacca gcgcaaaatc      1080
     atccaccgcg acatcaagcc ccaaaacatt ctcctcaacg aggcaggcca ggtgaagctc      1140
     tgcgacttcg gcgtgagcgg cgaggctgtc aactcgctcg ccactacgtt tactggcacc      1200
     tcgtactaca tggcgccgga gcgcatccag ggccagcctt acagcgtcac cagcgacgtc      1260
     tggtcgctgg gcctcaccct gctggaggta gcccaggccc acttcccctt cgactccggc      1320
     aaattcgcag ccaacatgcc gcccatagaa ttgcttatgc tgatcctcac cttcacgccg      1380
     cagctcaaag atgaacccga ggcgaacatc gtgtggagca aggccttcaa gtcattcatc      1440
     agctactgtc tcaagaagga gtcgcgcgag cggccctcgc ccaggcagat gctgcgccac      1500
     ccctggatac aggggcagat gaaaaagcgt gtcaatatgg agaagttcat ctacaagtgc      1560
     tggcaggcca ggtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page