(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE344

ASHGO_3.PE344        Location/Qualifiers
FT   CDS_pept        complement(592864..593943)
FT                   /codon_start=1
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749001"
FT                   /gene_name="RRD2"
FT                   /locus_tag="ACR139C"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   2"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51365.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI0000252855"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BY1"
FT                   /transl_table=1
FT                   /translation="MSDGAELKMAAQKRLLTGSDLDKWKASKTFEELLRFVSSLAQSVR
FT                   GRENSEHAEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARA
FT                   EALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEH
FT                   DFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLK
FT                   PKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDISGVRSWTKVSEGMV
FT                   KMYKAEVLGKLPIMQHFFFSRFLPVPDGVSPPRTSEEELADCSEHAHSTWGDCCGIPIP
FT                   SAVAASEATRKHSKPLPFD"
     atgagtgatg gggccgaatt gaagatggcc gctcaaaaac gcctgcttac aggcagcgac        60
     ctggacaagt ggaaggcgtc gaagacgttc gaggagctgc tgcggtttgt gtcaagtctg       120
     gcgcagtctg tgaggggcag ggagaacagc gagcacgcgg agcctgtgag cccggccatc       180
     gaggcactgg aggcgctgct ggaggagatg caaggcattg cagcgcacca cccggtgttg       240
     caggacgcgg cgacatcgcg gttcggaaag gtggagttcc gcgacttcca caaggaggtg       300
     caggcccgcg cggaagcgct ggtgctgcag gtggacccgt cgctgacgga cgagcaggcg       360
     caggagctgg cggtgtatct gggcaacgcg tggggcgact gcaagcggat cgactacggc       420
     tcggggcacg agctcaactt tgtgtgcttc ctgtacgggc tgtggaagta cggagtgctg       480
     tcggaacacg acttcacgaa cgcggtgctg cgggtgtttg tgaagtacat ggacgtgatg       540
     cgtgttctgg agaccaagta ctggctggag cctgcggggt cgcacggcgt gtggggtctg       600
     gacgactacc actttctgcc cttcctgttc ggggccttcc agctcgcgac gcacaagcac       660
     ctgaagccca aatcgatcca caacccggag gtggtggagc tgttcgagaa ccggtacctc       720
     tactttggct gcatcgcgtt catcaaccgc gtgaagacga ctgcctcgct gcgctggcac       780
     tcgccgatgc tcgatgacat cagcggcgtc aggtcctgga cgaaggtctc ggaggggatg       840
     gtcaagatgt acaaggcaga ggtgctgggg aagctgccga tcatgcaaca tttcttcttt       900
     tcccgctttc tgcctgtgcc ggacggtgtg tccccgcccc gcacctctga ggaagagctt       960
     gcggactgca gcgagcatgc ccacagtacc tggggcgact gctgcggcat tccgataccc      1020
     agcgcggtgg ccgcctccga ggccactcgc aagcattcta aaccacttcc attcgattga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page