(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE347

ASHGO_3.PE347        Location/Qualifiers
FT   CDS_pept        597519..600062
FT                   /codon_start=1
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622182"
FT                   /locus_tag="AGOS_ACR142W"
FT                   /product="ACR142Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51368.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058433"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI0001DB2865"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CE9"
FT                   /transl_table=1
FT                   /translation="MFHACGSSAARGLVAYLGSEYLRRNVDMDYITQPTQQGTQATQKY
FT                   VIEKFSQERIDDDVVCRVICTSGQLKIQDLKVDVREVVKKKEAIKQVWLFGRNRQSCDY
FT                   HLGDISRLSNKHFQIMLGEDGNLLLKDLSTNGTWLNDVRIEKGQNMILGQGDEITVGKG
FT                   VQQDVVNIVVFLNDNFQKKLETARLEGLRKPAKHTTLRTQSPRAPLTGIFKDFSINDEV
FT                   VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIVSLKGF
FT                   YEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLK
FT                   PDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGN
FT                   LYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYHEGPLKDYRISDEARDF
FT                   IDSLLQINPVDRLTAERALQHPWLHPCTSIGAEIAVSLSQSLSQARALEGMDEAEYLVA
FT                   QSEVASNRKAPTHEKRVILADHIAEENVGFRMPVHPPVRYTQKAQPVLGLEQDTRTHEE
FT                   PVETHNERQLEDNTALLEGSVDSHTTYSTSNMQQKRKPTRAADGLFLTLHPLANSSVRK
FT                   RIYVNQGINPFFIGRSDECHYKIPDNRLSRIHCFFLKKRHPVGNSIYESPAQGLDDIWY
FT                   CHNGTNVSYVNDMKLLPGTKVLLQDGDQVKVIWDKAQNITIAFRVEINDSAGLFNSAAV
FT                   TQNARHISQQTPDELALAVSFIELMRTQMHAIHNSETPPADTGSCSAVAAGNDAAASSI
FT                   LRKIHYSTLSQVPMKKAKRAKLAQADRNEDSLQFL"
     atgtttcatg cttgtggcag ctctgccgcc cgaggcctag tagcgtattt agggtccgaa        60
     tacttgcgca ggaacgtgga tatggattat atcacgcagc caacgcagca gggtacgcag       120
     gccacgcaga aatatgtcat tgagaagttc tcgcaagaac gcatagacga cgacgtcgtg       180
     tgcagagtca tatgcaccag cgggcagctc aagatccaag atctgaaggt ggacgtacga       240
     gaagtggtaa agaagaaaga ggcgataaaa caggtatggt tgtttggccg caaccggcag       300
     tcctgcgact accaccttgg ggacatcagc aggctgtcca acaagcactt ccagatcatg       360
     ctgggggagg acgggaacct gctgctgaaa gatttgtcca ccaatgggac gtggctcaac       420
     gacgtgcgta ttgaaaaggg gcagaatatg atattggggc agggggacga gataactgtg       480
     ggcaagggcg tgcagcagga cgttgtcaac atagtggtat tcctcaacga taacttccag       540
     aagaagctgg agacggcgcg gctggagggg ctgcgcaagc ctgccaagca cacaacgctg       600
     cgcacgcagt cgccgcgggc gccgctgaca ggcatattca aggatttctc tataaacgac       660
     gaggtcgtgg gccagggagc ctttgcgaca gtgaagaaag cggttgagcg caacaccgga       720
     aagacatttg ccgtcaagat catcaacaag cggaaggtaa tgggcaatgt ggatggggtc       780
     acgcgtgaac tggaggtcct gcggcgcctg aaccacccgc ggattgtgtc tctgaagggc       840
     ttctacgagg atgacgaaag ctactatcta ctgatggagt ttgtatctgg cggcgaccta       900
     atggactttg ttgctgccca tggctctgtg ggagaggatg caggtaggga gataaccagg       960
     caaatcctcg aagcggtccg ttacatacac gaacaaggaa ttagccatcg cgatctaaag      1020
     ccggacaaca ttctcataga gcaagacgac cctgtcctgg tcaaaatcac ggattttggg      1080
     cttgcaaaga tacaggataa cacgacattt atgaagacat tttgtgggac tttagcgtat      1140
     gttgcacctg aagtaattgg cgggaagaat ccggaaggca acggggccaa tggaaatctc      1200
     tactcatctc tagtggacat gtggtcgatc gggtgcctag tatatgttat tctgacgggc      1260
     caccttcctt tcagtggaag cacccaagag caactttata aacagatagc caatggctcg      1320
     tatcacgaag gtccgctgaa ggactacagg atctctgatg aggcacggga ctttatagac      1380
     tcgctactcc agataaaccc cgtcgacagg ctcactgcag aaagagccct ccaacacccg      1440
     tggctgcatc cttgcacttc gataggcgcc gagatagcag tgtccctttc gcaatctctg      1500
     tcgcaagcaa gggcactcga gggaatggac gaagccgagt acctcgttgc gcaatcggaa      1560
     gttgcgtcaa ataggaaagc gccgactcac gaaaagcgcg ttattcttgc agatcatatt      1620
     gctgaggaaa acgttgggtt cagaatgcca gttcatccgc ctgtccggta tactcagaag      1680
     gcccagccgg tactcggtct cgagcaagat accaggacac acgaggaacc tgtggaaaca      1740
     cacaacgaac ggcagctgga ggataataca gcgctcctag aaggcagtgt agacagtcac      1800
     accacgtaca gcacatctaa tatgcagcag aagcggaagc ccacgagggc agcggacgga      1860
     ctgtttttga cattgcatcc tttggccaac agtagcgtcc gaaaaaggat atacgttaac      1920
     caaggaatta accctttctt tataggcaga tcggatgaat gccactacaa gataccggat      1980
     aaccgcttat cacgaataca ttgctttttc ctcaagaaac gacatcccgt gggtaacagc      2040
     atctacgaat ctcccgcgca gggcctagac gacatctggt actgccataa cggaacgaat      2100
     gttagctatg tcaacgacat gaaattgctt ccagggacca aggttctgct gcaagatggt      2160
     gaccaggtaa aggtcatctg ggacaaggca caaaatatta caatagcctt ccgcgtcgag      2220
     ataaatgatt ccgctggact gttcaatagc gcagcagtaa cccagaatgc gcgccacatc      2280
     tctcagcaaa ctcctgacga gctcgccctg gcagtcagct tcatcgagct gatgcgcacg      2340
     cagatgcacg caatccacaa ttccgaaacg ccccctgcag acacgggctc ctgctccgcc      2400
     gtcgccgccg gcaacgacgc cgccgcctcc agcattttgc ggaagataca ctactccact      2460
     ctgtcgcagg tcccaatgaa gaaggccaaa cgtgccaaac tcgcacaagc tgaccgaaat      2520
     gaggatagcc tccaattctt atag                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page