(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE356

ASHGO_3.PE356        Location/Qualifiers
FT   CDS_pept        616344..618995
FT                   /codon_start=1
FT                   /gene_family="HOG000141722" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774744"
FT                   /locus_tag="AGOS_ACR151W"
FT                   /product="ACR151Wp"
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="AAS51377.2"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG353109"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0001DB2873"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BX0"
FT                   /transl_table=1
FT                   /translation="MNSLAQSVSSLSLDQGANRKHKRPHRAFHTFNEPPAMASGGGLQA
FT                   PRSALQAEGAAPLRAGSPVMGAGAGGSSAMAPPARSTHLVPTQRLEDQQQFLTRTFMPD
FT                   VEAVPPFSTTQFYCGVAGACDPRVLALSAYNIPKTEQLRAVTALPLGLNVQPFAPVVPS
FT                   DTAVPAVDARAGEGPLRCRRCRVYANPRFRFTSDSHFICNMCQVRTQLPPEEYSPLGPS
FT                   GERMDLASKAELTHGTVEFLAPELYNVHKGRAAVPLHYVFLVDISTWANENKSSLAAIE
FT                   GVRTAINYICEQQPNCKVAIIAYDKWLRFFNLRPESSQAQELIVSELREVFLPLYSGLF
FT                   VRPAEAMHVIQDTLVKLESFIQDDKLSHGAEACFGSALEAALLALDTATNGNGGKIIAT
FT                   LNTLPTVGNGNLTLRRDDGLKKSLKCDNSFYTALADRMLKAYVGLDLFCTGSAFMDFAT
FT                   LGHPVLATSGTFRHYSNFQLDRDEFPLVNDMLHAVSSTVGYQAQLKVRCSSGLSVSRYY
FT                   STACGHSDRDPVIPVVTADQSFTLALQYDSPLQAGTDVYFQASLLYTDLDGVRRVRTSN
FT                   TSAAVSDNIHEIFKFLNQDVVTALLVQDTLTALGDANFLGVRKSLDTRLAAILTQYRAL
FT                   VDPSHASQLILPDALKSLPAYLLAFQKSPLLRATGSARANDRAVDYLRFATYDLRRLAY
FT                   RLYPQILPLHVPLSDDDYTFYDAHNLLLQFPSADDLAVRAAHGALADGGCYLIFQGDTV
FT                   YLWLNDHTHPQLLRDLLAADAPPQLLPSARLPGLDTDISARVRSVLDYWAALAGRRALP
FT                   VQLLRPHSDPLYARTLSALVTEDASVDGLDSYDAHLVVLHRAIQDNLRHDRYLRPAAAR
FT                   DHDSLAQRYIQF"
     atgaatagtc tggcgcagag cgtttcgagc ttgtctttgg accaaggagc aaacaggaag        60
     cacaaacggc cgcatcgggc gttccacacg ttcaatgagc cgccggccat ggccagcggc       120
     gggggtctgc aggcgccgcg gtcggcgctg caggcggagg gggcggcgcc cctgcgagcc       180
     gggtcgccgg tgatgggggc aggggccggg ggcagcagtg cgatggcgcc gcccgcgcgg       240
     tcgacgcacc tggtgccgac acagcggctg gaggaccagc agcagttcct gacgcggacg       300
     ttcatgccgg acgtggaggc ggtgccgccg ttttccacga cgcagttcta ctgcggggtg       360
     gcgggggcgt gcgacccgcg cgtgctcgcg ctttcggcgt acaacatacc caagaccgag       420
     cagctgcggg cggtgacggc gctgccgctg ggtctgaacg tgcagccgtt cgcgccggtg       480
     gtaccgtcgg acacggcggt gccggcggtg gacgcgcgcg caggcgaggg cccgctgcgc       540
     tgcagacggt gccgggtgta tgcgaacccg cgcttccggt tcacgtcgga ctcgcacttc       600
     atctgcaaca tgtgccaggt acggacgcag ctcccccccg aggagtactc gccgctgggt       660
     ccgagcggcg agcgcatgga cttggcttcc aaggcggagc tgacacacgg cacggtggag       720
     tttctggcac cggagctgta caacgtgcac aagggacgcg ccgcggtgcc gcttcattat       780
     gtgttcctag tggacatctc gacgtgggcg aacgagaaca agagctcgct ggcggccatc       840
     gagggtgtcc gcaccgcgat caactacatc tgcgagcagc agccgaattg taaggtggcc       900
     atcatagcat atgacaagtg gctgcgtttc ttcaacctgc gcccggagtc gagccaggca       960
     caggagctga ttgtgtccga gctcagagaa gtcttcctgc cgctgtacag cggcctcttc      1020
     gtgaggcctg cggaggcaat gcatgtcata caggacacgt tggtcaagct cgagtcgttt      1080
     atccaggacg acaagctctc gcacggcgcc gaggcgtgct tcgggtcggc gctcgaggcc      1140
     gcgctgctgg cgctggacac tgccaccaat ggtaatggcg gcaagatcat tgcgactctg      1200
     aacacgctgc ccaccgtggg caacggcaat ctgacgctgc ggcgcgacga cggcctcaag      1260
     aagagcctga agtgcgacaa cagcttctac accgcgctgg cggacaggat gctgaaggcg      1320
     tacgtcggcc tggacctctt ctgcacaggc agcgccttca tggactttgc cacgctcggc      1380
     caccccgtgc tggccacctc cgggacgttc cgccactact cgaacttcca gctcgaccgc      1440
     gacgagttcc cgctggtcaa cgacatgctg cacgccgtca gcagcaccgt cggctaccag      1500
     gcgcagctca aggtgcgctg ctcctcgggg ctgtccgtca gtcgctacta ctcgaccgcg      1560
     tgcggccact ccgaccgcga ccccgtcatc cccgtcgtca ccgcagacca gagcttcacg      1620
     ctcgcgctgc agtacgacag cccgctgcag gcaggcaccg acgtctactt ccaggcctcg      1680
     ctgctctaca cagacctcga cggcgtgcgc agagtgcgca ccagcaacac ctccgccgcc      1740
     gtcagcgaca acatccacga gatattcaag ttcctcaacc aagacgtcgt caccgcgctg      1800
     ctcgtccagg acacactcac cgccctgggc gacgccaact tcctcggcgt ccgcaagtcc      1860
     ctcgacaccc gcctcgccgc catcctcacg cagtaccgcg cactcgtcga cccctcccat      1920
     gcctcgcagc tcatcctgcc cgacgcactc aagtcgctgc ccgcgtacct gctcgccttc      1980
     cagaagtcgc cactgctgcg cgcgaccggc tccgcccgcg ccaacgaccg cgccgtcgat      2040
     tacctgcgct tcgcgaccta cgacctgcgc cgcctcgcat accgcctcta cccgcagatc      2100
     ctccccctcc acgtcccgct gtccgacgac gactacacct tctacgacgc ccacaacctg      2160
     ctgctgcagt tcccgtccgc cgacgacctc gccgtccgcg ccgcccacgg cgccctcgcc      2220
     gacggcggct gctacctcat cttccagggc gacaccgtct acctctggct caacgaccac      2280
     acccacccgc agctgctgcg cgacctgctc gccgcagacg caccgccgca gctgctgccc      2340
     agtgcccggt tacccggcct cgacacagac atctccgcca gggtccgcag cgtgctcgac      2400
     tactgggccg cgctcgccgg ccgccgcgcg ctgcccgtcc agctgctgcg cccccactcc      2460
     gacccactct acgcccgcac cctctccgcc ctcgtcacag aggacgcctc tgtcgacggc      2520
     ctcgacagct acgacgccca cctcgtcgtt ctgcaccgcg ctatccagga caatctgcgt      2580
     cacgaccgct acctgcggcc cgccgccgcc cgcgaccacg acagccttgc ccagcgctac      2640
     atccagttct ga                                                          2652
//

If you have problems or comments...

PBIL Back to PBIL home page