(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE368

ASHGO_3.PE368        Location/Qualifiers
FT   CDS_pept        640498..640710
FT                   /codon_start=1
FT                   /gene_family="HOG000109502" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775009"
FT                   /gene_name="RPB10"
FT                   /locus_tag="ACR163W"
FT                   /product="DNA-directed RNA polymerases I, II, and III
FT                   subunit RPABC5"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51389.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG007661"
FT                   /db_xref="HOGENOM:HBG391971"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="UniParc:UPI000025286C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BV8"
FT                   /transl_table=1
FT                   /translation="MIVPVRCFSCGKVVGDKWEAYLNMLQEEELDEGTALSRLGLKRYC
FT                   CRRMILTHVDLIEKFLRYNPLEKRD"
     atgatcgtgc ctgttcggtg tttctcttgt ggaaaggttg tgggtgacaa atgggaggcg        60
     tacctgaaca tgcttcagga agaggagctt gacgagggta cggctctgtc ccggttgggc       120
     ctgaagagat actgctgcag aagaatgatc ctgacgcatg ttgacctgat cgagaagttc       180
     ctgcggtaca acccacttga aaagcgggat tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page