(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE381

ASHGO_3.PE381        Location/Qualifiers
FT   CDS_pept        complement(660654..661016)
FT                   /codon_start=1
FT                   /gene_family="HOG000210889" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079254"
FT                   /locus_tag="ACR176C"
FT                   /product="Guanine nucleotide-binding protein subunit gamma "
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /cellular_component="heterotrimeric G-protein complex "
FT                   /protein_id="AAS51402.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005834"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG058451"
FT                   /db_xref="HOGENOM:HBG397684"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniParc:UPI0000252879"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BU5"
FT                   /transl_table=1
FT                   /translation="MATGCTQHLYRRRGAQKVLETFAQTKRFRTMAEQRLPPKIQYLKL
FT                   KRTEELNNKLKKELARERITASNACLSIIDYTSTNKDYAVPEVWGYMKPGENHFRASAK
FT                   QARPRGGHEGSCCCIM"
     atggccacgg gctgcacgca gcatttatat agacgacggg gcgctcagaa ggtgctcgag        60
     acattcgctc aaacaaagcg attcagaacg atggcggagc agcggctccc ccccaagata       120
     cagtacttga agctgaagcg gaccgaggaa ctgaataaca agctgaagaa ggagctggcc       180
     cgcgagagga ttaccgcatc caatgcatgc ctgagcatca tagactacac gtccacgaac       240
     aaagactacg ccgtgccaga ggtctgggga tatatgaagc cgggcgagaa ccatttccgt       300
     gcgtctgcca agcaggcgcg accccgaggt ggccacgaag gttcctgttg ctgcattatg       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page