(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE384

ASHGO_3.PE384        Location/Qualifiers
FT   CDS_pept        complement(663330..664568)
FT                   /codon_start=1
FT                   /gene_family="HOG000000818" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622462"
FT                   /gene_name="CSN12"
FT                   /locus_tag="ACR179C"
FT                   /product="COP9 signalosome complex subunit 12 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="AAS51405.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG058453"
FT                   /db_xref="HOGENOM:HBG202251"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI0001DB26DA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BU2"
FT                   /transl_table=1
FT                   /translation="MIQAVTSCFQFKRCTTHLLEFIAADKPMVGDALADPSDEKLAHFV
FT                   RTTAALKIEYRCAQGPSPRVFELALAQLRALNRIAEWESGWVVYPLYTCARQLVQMAAA
FT                   LDARTERAAEAAQCGDLATEDHLTQCGRAVHMSLNLCLKDRDPAASNKRHGAYYFALLL
FT                   FRTYARLGAHSLVTNMVKVLESRAQDLPPVERAFGERRALTVTYCYYLGRYHACRRADY
FT                   EKGFRWLNTALLTCHRDHTRHHQLILTYLVPVAFLARRWYPKHHVIAAWPPPQDPAAIH
FT                   YAALVAALRSGDLGLYDRELVRMQLPLLRRGLYLPLSHLRPYILLRLVKAVWRLSGGSS
FT                   QLPIRIIAAALAYSTSATPDAGGERLLDHTECLLANLIARGYVKGYLSHGNRVLVVSRT
FT                   EPFPRLVRSETAA"
     atgatacagg ccgtaacttc ctgcttccag ttcaaacgct gcacgacgca tctgctggag        60
     ttcattgcag cggacaagcc catggtgggc gacgcactcg cggatccatc agatgagaag       120
     ctggcgcact tcgtgcgcac aaccgcggca ctgaagatcg agtatcgctg cgcgcagggc       180
     ccgtcgccga gggtgtttga attggcgctg gcacagctgc gggcgctcaa ccgcattgcg       240
     gagtgggagt ccggctgggt cgtgtacccg ctgtacacgt gcgcgcggca gctggtgcag       300
     atggcggccg ccctggacgc gcgcacggag cgcgccgccg aggccgctca gtgtggtgac       360
     ctcgcgacgg aggaccacct gacgcagtgc ggccgcgccg tgcacatgtc gctgaatctg       420
     tgcctcaagg accgcgaccc ggcagcgtcc aacaagcggc acggcgccta ttacttcgcg       480
     ctgctgctct tccgcaccta cgcgcgcctc ggcgcgcaca gccttgtgac caacatggtc       540
     aaggtgctgg agtcgcgcgc ccaggacctg ccgccggtgg agcgcgcctt cggcgagcgc       600
     cgcgcgctca ccgtcacgta ctgctactac ctcggccgct accatgcctg tcgccgcgcc       660
     gactacgaga agggcttccg ctggctcaac accgcgctgc tcacgtgcca ccgcgaccac       720
     acgcgccacc accagctcat cctgacctac ctggtgccgg tggccttcct ggcgcgccgc       780
     tggtacccca agcatcacgt gatcgccgcc tggccgccgc cccaggaccc cgcggcgatc       840
     cactacgccg ccctggtcgc tgcgctgcgc tctggcgacc tcgggctgta cgaccgcgag       900
     ctcgtgcgca tgcagctgcc gctgctgaga cgtgggctgt acctaccgct aagccatctg       960
     cgcccgtaca tactgctgcg gctggtcaag gccgtttggc gcctgtccgg gggctcatca      1020
     cagctcccga tccgcattat cgctgcggcg ctggcatact caacgtcagc cacgccggac      1080
     gctgggggcg agcgcctact ggatcatacg gagtgccttc tggccaatct catcgcgagg      1140
     ggctatgtga agggatattt gtcacacggg aaccgggtac ttgtcgtaag caggacagaa      1200
     ccattcccta gactcgtgcg tagcgaaacc gcggcatga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page