(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE386

ASHGO_3.PE386        Location/Qualifiers
FT   CDS_pept        complement(665494..666915)
FT                   /codon_start=1
FT                   /gene_family="HOG000066030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750054"
FT                   /locus_tag="ACR181C"
FT                   /orf_name="AGOS_ACR181C"
FT                   /product="ACR181Cp"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="AAS51407.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG020914"
FT                   /db_xref="HOGENOM:HBG203959"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000025287E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BU0"
FT                   /transl_table=1
FT                   /translation="MAVAQGVQKILLDSTHFNDIRNTISSRHVAWDALVRSAELSEFDA
FT                   GIAKKLESTLLKHARGGALDLPLEQGVQALVHLLATSNNLDAKRAVLNLLSELFTSDKY
FT                   VHEVLRYFKKGPELVRKLYESTLTDSAADDQFVLLSCFNVVSLLIQEGLQSEELVEALV
FT                   SNPNYLRVLTNLERMELAYVCIRLLQELVAVKRYRRLVWKHSAKFVPVIFQIIDWALDG
FT                   RSSTRVVPTNSNNLGIQAQYYALLTLWLLSFEPQIAADLSHTYLSELLKLFKLVKVTIK
FT                   EKVTRLSIAILLNCVAAQVKGRKATIKNLLLLGSGLPILQQLSERKYSDDELREDLSQL
FT                   HGILESEYHELTSLDEYVAELDSKLLVWSPPHTDNTFWSENAHKFKEENWKLFKQLINV
FT                   LKELSTSHDSSDNVALQVVLNDITHIVELQPECVDILGKLNAKVIIMELLNHPNSKVKY
FT                   EALKTTQAFVANTFK"
     atggccgtgg ctcagggggt tcaaaagatt ctgcttgata gcacgcactt caacgatatc        60
     cgcaatacga tcagctcgag gcatgtggcg tgggacgcgc tggtgcggtc ggccgagctg       120
     agcgagtttg acgcggggat tgccaagaag ctcgagtcga cgttgttgaa acacgcgcgc       180
     ggcggcgcgc tggatctgcc gctggaacag ggcgtgcagg cgctggtgca cctgctggcg       240
     acgtcgaaca acctggatgc gaagcgggcg gtgctgaacc tgctgtcgga gctgttcacg       300
     agcgacaagt acgtgcacga ggtgctgcgg tacttcaaga agggcccgga gcttgtgcgc       360
     aagctgtacg agtcgacact gacggacagc gcggcggacg accagttcgt gctgctgtcg       420
     tgcttcaacg ttgtctcgct gctgatccag gaggggctgc agagcgagga gctggtggag       480
     gcgctggtgt cgaaccccaa ctacctgcgg gttctgacta atctggagcg catggagctg       540
     gcatacgtgt gcattcgctt gctgcaggag ctggtggccg tgaagcggta ccggaggctg       600
     gtgtggaagc acagcgccaa gtttgtgccg gtaatattcc agatcatcga ctgggcgctg       660
     gacgggaggt cttccacgcg ggtagtcccc acgaacagca acaaccttgg catccaggca       720
     cagtactacg cgctgctgac actttggctc ctcagctttg agccgcaaat tgccgccgac       780
     ctgtcccaca cgtatctgtc ggagcttctc aagctgttca agctggtgaa ggtcacaatc       840
     aaggaaaagg ttacccgctt gtccattgcc attcttctga actgcgtcgc cgcgcaggtc       900
     aagggccgca aggccaccat aaaaaacctg ctgttgctgg gctccggctt gcctatactc       960
     cagcaactga gcgagcgcaa atacagcgac gacgaattgc gcgaggatct gtcccaacta      1020
     cacggtatcc tcgaatcgga gtaccatgag ttgacgtcct tggatgagta cgttgcggaa      1080
     ctggactcca agctgttggt atggtcgcca ccccacaccg acaacacgtt ctggtcggag      1140
     aacgcgcaca agttcaagga ggagaactgg aagctgttca agcagctgat aaacgtgttg      1200
     aaggagctca gcacatcgca cgatagcagc gacaacgtcg cactgcaggt agtcctcaac      1260
     gacatcaccc acatcgtgga gctacagccc gagtgcgtgg atatccttgg aaagctcaat      1320
     gcgaaggtca taatcatgga attgctaaac caccccaact ccaaggtgaa gtacgaggcg      1380
     ctaaagacca cgcaggcatt cgtggctaac acgttcaagt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page