(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE391

ASHGO_3.PE391        Location/Qualifiers
FT   CDS_pept        671404..672579
FT                   /codon_start=1
FT                   /gene_family="HOG000066089" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750055"
FT                   /gene_name="EAF6"
FT                   /locus_tag="ACR186W"
FT                   /product="Chromatin modification-related protein EAF6 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51412.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058457"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniParc:UPI0001DB26DB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BT5"
FT                   /transl_table=1
FT                   /translation="MSSVSRRYISLVKPGSSSVPPIARLLAPNAAAKALFPSEDLGSTQ
FT                   FELLGESGTLARAAVPAGTSLYVRRGCMVSLYNRSGLRDIAMSHQWLQPAARMLRYRSL
FT                   KASIYYRLSSPAHLNCLLAPNFMSQQLWRARPVAGRTLCPLTLDGTSDWFVFGRDAVVA
FT                   YESNSSLVIQEGPFRWPLRRAHPLGSKLQLAQGRGSLLLSGYGTVYRVDLKDAADELIL
FT                   QRRHLLAINGAAPADIHACATPYDMLPPARAARVVPPLVSLSADRRVHVEWSNLCRWFS
FT                   AQASHARSLAQRLYARYLHGPSDFVKIRGPRTLMVQSMYSGSAPLPSVPARAAPQPLYT
FT                   TDMDSLPELKVSDAKNYLSYASVGPDGNVSFRSTPDFKDSVKQIELAKNRR"
     atgtctagcg tttctaggag atatatatcg cttgtgaagc ctgggtcgtc gagcgttccg        60
     cccattgcgc gcctgctggc gcctaatgca gcagcgaagg cgctgttccc gtcggaggat       120
     ctcggcagca cgcagttcga gctgctgggc gagtccggga cactggcgcg ggcggccgtg       180
     ccggccggga cgtcgctcta cgtgcggcgc ggctgcatgg tgtcgctgta caaccggtcc       240
     gggctgcgcg acatcgcgat gtcgcaccag tggctccagc ccgcggcgcg gatgctccgg       300
     taccgctcgc tgaaggcgtc gatctactac cggttgtcga gccccgcgca cctcaactgt       360
     ctgctggcgc ccaacttcat gtcgcagcag ctgtggcggg cgcggcccgt cgcgggccgc       420
     acgctctgcc cgctgacact cgacggtacg tccgactggt tcgtcttcgg ccgagacgcc       480
     gtcgtggcct acgagtccaa ctcgtcgctc gtcatacagg aaggcccgtt ccggtggccc       540
     ttgcggcgcg cccacccgct gggctccaag ctgcagctgg cgcagggccg cggcagcctg       600
     ctacttagcg gctacggcac cgtgtaccgc gtcgacctca aggacgcggc ggacgagctc       660
     atcctgcagc gccggcacct gctggcgatc aacggcgcgg cgccagcaga catccacgcc       720
     tgcgccacgc catacgacat gcttccgccg gcgcgcgcgg cccgcgtggt cccaccactc       780
     gtgtcgctca gcgcggatcg ccgagtgcac gtggagtggt ccaacctctg ccgctggttc       840
     tccgcacaag cctcgcacgc ccgcagcctg gcgcagcgcc tatacgcccg ctacctccac       900
     gggccttccg acttcgtcaa gattcggggg ccccgcacgc tcatggtcca gagtatgtac       960
     agcggtagcg ctcctcttcc cagcgtgcca gcccgcgctg cgccccagcc actctacacc      1020
     acagatatgg actcgctgcc tgagctgaag gtttcagacg cgaagaacta cctcagctat      1080
     gcgtcggtcg ggccagacgg caatgtttcg ttccgcagca cccctgactt caaggattcc      1140
     gtgaagcaaa tcgaattggc caagaacagg aggtaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page