(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE399

ASHGO_3.PE399        Location/Qualifiers
FT   CDS_pept        complement(690191..691732)
FT                   /codon_start=1
FT                   /gene_family="HOG000234710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079256"
FT                   /locus_tag="ACR194C"
FT                   /product="WD repeat-containing protein ACR194C "
FT                   /protein_id="AAS51420.1"
FT                   /db_xref="HOGENOM:HBG056028"
FT                   /db_xref="HOGENOM:HBG397654"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000025288B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BS7"
FT                   /transl_table=1
FT                   /translation="MTANSEFNKRRLENIKRNNELLKKLNLAGIPARIRSEAGIEDHRK
FT                   ASGGAVKKKQGKAPVKREAKPAPIPTRRSRRLRGEAADVEGEAGAGSDTAQNVKQEEEW
FT                   KELKEARVVGDIKLSDLIKSEDDGELLEKFRRYADKSFSGGDFFEELQRHQKPNPEVQR
FT                   LREEMRLQQYDVFDPKELAIVHERVTALCFHPSQEKKLIVGGDTAGTVGLWNVADENPD
FT                   PEHPDSVPDITRFKLFSRNVSKIEVFPTDSSKILAASYDGALRSIDMQSLKSDELLHFQ
FT                   NEHGDTLGISDCQFSYDSPNVVMLTTLGGEFAQRDLRTKPDTMNIMRLSDKKIGCMAID
FT                   PSRPYSVATASLDRTLRIWDLRKTVAKPDWSQYEDYASHEVVSTYNSRLSVSAVSYAPI
FT                   DHTLVCNGYDNTVRLFNARADLPSELQPDFTIQHNCKSGRWVSVLKARFKLNMDVFAIA
FT                   NMKRAIDIYTSRGEQLSHLETSTVPAVVSWHPMQNWIVGGNNSGKVFLFTDAPQE"
     atgacggcca atagcgagtt taataagcgg cgcctggaga atattaagcg caataatgaa        60
     ttgctgaaga aactcaacct tgcaggtatc cctgccagga taagaagcga ggcaggcatc       120
     gaagaccatc ggaaggcatc gggcggggca gttaagaaaa aacagggcaa ggcccctgtt       180
     aagagggagg cgaaaccagc acctattccg actaggcgtt ccaggcgtct gcgaggggag       240
     gccgctgatg tggaaggcga ggccggcgcg gggagcgaca cagcacagaa tgtgaaacag       300
     gaagaggagt ggaaagagct gaaggaggcg cgcgtggtcg gtgacataaa gcttagcgac       360
     ctcatcaagt cggaggacga tggcgagctc ctggagaagt ttcggcggta tgccgataag       420
     agcttttccg gcggtgactt cttcgaggag ctgcagcggc atcagaagcc gaatccagag       480
     gtgcagcggc tgcgagagga gatgcggctg cagcagtatg acgtttttga cccgaaggag       540
     ttggccattg tgcacgagcg ggttacggca ctctgcttcc atccttccca ggagaagaag       600
     ctgatagtcg gcggtgacac agcgggcacg gtggggctgt ggaacgttgc ggacgaaaac       660
     ccggacccag agcatccgga ctccgtccca gatatcaccc gcttcaagct tttttccagg       720
     aatgtcagca aaatagaggt gttccccaca gactctagca agattctagc tgcctcctac       780
     gacggcgcat tgcggtctat tgacatgcag tcgctaaaaa gcgacgagct gctccacttt       840
     caaaatgaac atggtgacac gctcgggatc agcgactgcc agttcagcta tgacagtccg       900
     aacgtggtca tgctcaccac cctaggaggc gaatttgctc aacgagacct ccgtaccaag       960
     cccgatacaa tgaatattat gcgtctatcg gacaagaaaa tcggatgcat ggccattgac      1020
     cccagcaggc cctacagtgt ggcgacagcc tccctggaca gaacgctgcg tatatgggac      1080
     ttgcgcaaga ccgtggccaa acctgactgg tcccagtacg aggactacgc cagtcacgag      1140
     gttgtctcga catacaattc aaggctgtcc gtttccgctg tatcgtatgc gcccatcgac      1200
     catacgcttg tctgcaacgg atatgacaac acggtccgtc ttttcaacgc aagagccgac      1260
     ttaccttctg aattgcagcc agacttcacc atacagcaca attgtaaatc gggacgctgg      1320
     gtcagcgtac tcaaggctcg cttcaagctg aacatggatg tctttgccat tgcaaacatg      1380
     aagcgtgcca tcgacatata caccagtcgc ggtgagcagc tatcccacct ggagacatcg      1440
     acggtgcccg ccgtggtcag ctggcatcca atgcaaaact ggattgttgg agggaataac      1500
     agtggcaagg ttttcttgtt cactgacgct cctcaggaat aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page