(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE410

ASHGO_3.PE410        Location/Qualifiers
FT   CDS_pept        complement(704697..704954)
FT                   /codon_start=1
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750064"
FT                   /gene_name="LSM6"
FT                   /locus_tag="ACR204C"
FT                   /product="U6 snRNA-associated Sm-like protein LSm6 "
FT                   /function="RNA binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51430.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="HSSP:1MGQ"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0000252895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BR7"
FT                   /transl_table=1
FT                   /translation="MSSAMQGPAVTSSSTFLSNIIGKPVNVKLHSGMLYQGTLESIDGF
FT                   MNVALVDASEYYESEQNPVIHRYESDVFLRGTQVMYISEL"
     atgagttccg cgatgcaagg cccagcggtg acgtcgtcgt cgacgtttct gtcgaatatc        60
     attggcaagc cggtcaacgt gaagctgcac tccgggatgc tgtaccaggg cacgctcgag       120
     tcgatcgacg ggttcatgaa cgtggcgctg gtggacgcga gcgagtacta cgagagcgag       180
     cagaacccgg tgatccaccg gtacgagtcg gacgtgttcc tgcgcggaac gcaggtgatg       240
     tacatcagcg agctgtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page