(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE414

ASHGO_3.PE414        Location/Qualifiers
FT   CDS_pept        711699..714320
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750068"
FT                   /locus_tag="AGOS_ACR209W"
FT                   /product="ACR209Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51435.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058465"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB26F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BR2"
FT                   /transl_table=1
FT                   /translation="MLQMALMHRPNEKRKVARRACLACRDKKIRCDGEARAERGGDPAV
FT                   CSNCALQRLECVFVRSQRGGRRPPKKQLPHTKFLLQTFGPMRMAEAKLDRGASRVRLAP
FT                   PFTQSRSRDCMDDELRDPRYCLQVAPLETAAPSTPMREFSTASNLGRCQRYLLPPHVPH
FT                   SGPRSSPVAQPGQCMQPPVSGGTAFPKLPIEQPMPPHAAFHPSTCAASLKPSRRASLGV
FT                   GSSPSAFPLPFTSHAVRPMTMTNPAVQLMSSKDSAAGSTQCRSSCNTDTRLSPFTSSMT
FT                   LNTVHNNTVRSSDAAQYSVGRYHADFGSLPSEVVEQCIDAYYIYVEPHLRLLSDSEERP
FT                   ENVGTLNSAVQSAIFLCASPYVKHSITYDSAYFLDMLRKSWHKLENEYAIVQHVLLLCY
FT                   FYLNHTPLSGNCKSTIEKLIRILILGKVPDSLARKHTDMQLAQFVPRAMAENCAHMLQL
FT                   LCRVFYLLQKIMLFSQDSKWLASLLSSLNVDNLMKAFIPVGVPTSYKYTGKLFSTKSHL
FT                   PSTEHMLHVLYSSWQEGRIPNNEFIGTLQQMQPSINANVYRLGDMNTIHLQSISNLNVK
FT                   VVSDSMLLRYLSCCSRDGIKFQLDLRAPDSDVSMQSAHGFLTRILSDLDAWTIRQLLLQ
FT                   LFILADILYSLGLAANGMPSTRLPDMKSRYNMSQPSRSKRSNAISCSSSNSPLSTEETH
FT                   GFRTEVWCDEEYISKKSILQLEESNSSTEMLHGDGSAGEAVGVSCGPYPEFFDNLLVDM
FT                   LPTLVVIILLFSNYVVPQYAGGKWTFKSPAKRRIPIGDMTFNGEFKDICSGTLLFHTIP
FT                   AEDITQDVVFQMLDTIINGRSILCQLRSYADTVVVKSQRLNYNSAISRNLTKLLALLGA
FT                   VV"
     atgttgcaga tggcattgat gcataggcct aatgagaaac ggaaggtggc cagacgcgca        60
     tgtctggcgt gccgggacaa gaagatcagg tgcgatgggg aggcgcgggc ggagcgtggc       120
     ggggatcctg cggtgtgctc gaactgcgcg ctgcagcgcc tggagtgcgt cttcgtgcgc       180
     tcgcagaggg gagggcggcg gcctccgaag aaacaattgc cgcataccaa gtttctgctc       240
     cagacgtttg ggccgatgag aatggcggag gcgaagctcg acaggggcgc gagccgggta       300
     cgtctggcac cgccgttcac gcaatcgcgg agtcgcgatt gcatggatga tgagctgagg       360
     gacccgcgat actgcttgca ggtagcccca ctagaaacag cagccccgtc gactcccatg       420
     cgcgagttta gtacagcctc gaatctagga aggtgccagc gatacctgct cccgccgcac       480
     gtgccccatt cagggccgcg ctcatcgcca gtcgcccagc caggccagtg catgcagcct       540
     cccgtttcgg gaggcacggc gttcccgaaa ttgcccattg agcagcccat gcccccacac       600
     gcagccttcc accctagcac atgcgctgcg agtctgaagc cttctcgtag ggcatcattg       660
     ggggtgggaa gctcaccgtc agcatttccc ttgccgttca caagccatgc tgtgcgacca       720
     atgaccatga ctaaccctgc agttcaattg atgtcctcga aagactctgc ggctggcagc       780
     acccagtgcc gaagctcatg taacaccgac acacgactat ctccttttac ctcgtctatg       840
     acattgaata ctgtgcacaa taacactgtg cgttccagtg acgcggcaca gtactccgtt       900
     ggccgctacc acgctgactt tggctctctt ccatcggaag tggttgaaca gtgtattgat       960
     gcgtattaca tatatgttga accgcatttg cggctgcttt cagactctga ggaacgccct      1020
     gagaatgttg gcacactgaa ctctgctgta caaagcgcca tctttttatg tgcatcacct      1080
     tatgtcaaac atagtattac ctacgattca gcgtatttct tagatatgtt gaggaaaagc      1140
     tggcataaac tggagaatga atatgcaatt gtgcagcatg ttttacttct ttgttacttc      1200
     tatttgaatc ataccccatt atcaggcaac tgcaagtcca cgatagagaa actaattcgc      1260
     atcctaatac ttggcaaggt cccggattct ttagctcgaa aacacacgga tatgcagctt      1320
     gcacagtttg tgccgcgtgc catggctgag aactgtgctc atatgctgca attgctgtgc      1380
     cgcgttttct acctcctcca gaagataatg cttttctcgc aggattcaaa atggctggca      1440
     tcgctcctga gctcgttgaa tgttgataat ttaatgaagg cattcatacc agttggtgta      1500
     ccaacaagct acaaatacac tggtaagcta ttctccacca aatcccacct gccttcaacc      1560
     gaacatatgc ttcatgtact ttacagctct tggcaagagg gcaggatacc taacaatgaa      1620
     tttattggca cgcttcaaca aatgcagcct agcattaatg caaacgtcta cagactcggt      1680
     gatatgaata caatccacct gcaatctatc tcgaatttaa acgttaaagt tgtttcggat      1740
     agtatgcttc ttcgatacct cagctgctgc agtcgagatg ggataaagtt ccaacttgac      1800
     ttgagagcac cagattctga tgtgtccatg caaagcgctc acggattttt aacacggata      1860
     ctttcagact tggatgcctg gactatccgt cagttactgc ttcagctgtt tattctagcg      1920
     gatatcctct attcgctagg cctggccgca aatgggatgc cttctacaag gctccctgat      1980
     atgaaatcca gatacaatat gtcccaaccc tcgaggagca aaagaagtaa tgccatttca      2040
     tgctcgtcct ccaactcacc gttgtcgacg gaagaaactc atggctttcg aactgaggtt      2100
     tggtgtgatg aagaatacat ttcaaagaag tcaatactac aacttgaaga gtctaattca      2160
     agcacagaaa tgttgcatgg cgacggttcc gcaggtgaag cggtcggtgt atcctgcggg      2220
     ccctaccccg aattttttga taacctcctg gtagacatgc tacctaccct ggtagtgatt      2280
     attcttctat tcagtaacta cgtggtgcca cagtatgctg gtggtaaatg gacattcaaa      2340
     tccccagcta aaagaagaat ccctatagga gatatgactt ttaacggtga attcaaagat      2400
     atatgctcgg gaactctttt attccataca attcccgcag aagatataac ccaagatgtg      2460
     gtttttcaaa tgttagatac cattattaac ggaaggtcta tattatgcca gctgcgttcg      2520
     tatgcagata ccgtggttgt aaaatctcaa aggctcaatt acaatagtgc cataagtcgg      2580
     aacctcacaa aattacttgc gctccttgga gcagttgtat aa                         2622
//

If you have problems or comments...

PBIL Back to PBIL home page