(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE42

ASHGO_3.PE42         Location/Qualifiers
FT   CDS_pept        complement(67788..71957)
FT                   /codon_start=1
FT                   /gene_family="HOG000094458" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747759"
FT                   /locus_tag="AGOS_ACL164C"
FT                   /product="ACL164Cp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS51064.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG058469"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001DB2711"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CT3"
FT                   /transl_table=1
FT                   /translation="MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLD
FT                   DVRVTVSLSEEGREVLRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQNR
FT                   VHVFMGVLCDPGQRFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHP
FT                   WDKPDFCLFEDGDPAVVDSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLE
FT                   VCKRHPDLDPSDIPSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWL
FT                   VTKFGFELCEIEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRL
FT                   VPKDVVVSNSKLRSFQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNY
FT                   YYSDRDIIKNYEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSA
FT                   LRLFHLDPSSTDPRQLSDEFLLESYKEVCKDSGPQKHADLRNALRLLARYKESDKLKFY
FT                   VEVEPFPNELQAYKLLEIDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSI
FT                   ILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPE
FT                   QLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQY
FT                   YFTISPLREYILAYDHTASNLLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSL
FT                   FHEMVHSRERYVTPTRELAYLSFSPSSTEVEFEPVPPAVGTASNALVANEVYNEDTEVI
FT                   DISMEECDEDSAINELGASNISVKLDSDIGTDSNSNLATGAQTGIPLDGHTDLNTGIRT
FT                   CMPNDTAINMATGNATAPNKGIVNSEANFEHLMTPAPHEGTDKPIGNDQSVVPNLGTSK
FT                   DTLSAYPKSGYAKTAASALSTNNSAASPDDFSVRYQASSDTANTGSTRPNPSSTPESGL
FT                   SDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLENTL
FT                   EIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRK
FT                   RTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQ
FT                   IQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRER
FT                   RRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHLDALRVALDEEL
FT                   AALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKY
FT                   NDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLLA"
     atgaatcagg aatcgcgcga acagatcgag acggagcaga attgcgagct cgagcaggga        60
     gacgatggac gcacagtact ctatgggaat ctagcgcggc aggggccggt caagacgtcg       120
     gaccgccttc tggacgacgt gagggtgacg gtgtcgcttt cagaggaggg gcgcgaagtg       180
     ttgcgggcgc ccatgctgga gtatgcgcgg cagcgcgcga acgcgcgcac ctggtccgtg       240
     gggtacctgc ttgatcaggt agtgctgcag acgagcttcg agtacacctc acgtacatgc       300
     gcgcagaacc gggtgcacgt gttcatgggg gtgctatgcg accccgggca gcggtttgcg       360
     agccaagacg agctggtgaa ctaccgtatc taccacctgc gtgtgacagt gaagatccgg       420
     ccgcagctgg aacgggcccg gcagcactac ggcgttgcgc agtaccacct ggtcgacgaa       480
     ttgcacccat gggacaaacc cgacttctgt ttgtttgagg acggcgaccc tgctgtggtc       540
     gattctgcga cctacgtggc aagtgggacc aacaggcttg tccggataga agtcctccgg       600
     ccagagttcg gccccgatga gttacaagag tttaccggcg agcgtatccg cgcgcgatat       660
     ctcgaggtat gcaagcggca cccggatctg gacccatcgg atatcccgag ccaggcagag       720
     tgccttaata cgctgttcaa ggttttcaaa aacccactca gccgccagaa ggcgcaagat       780
     gagctaaaaa cgatatctgc cgacaacaag gtgctgaatt cccagctgga agctaattgg       840
     ctggtgacga agtttggctt tgaactctgc gagatcgagg aagatgggca gaaaatatat       900
     gaatacaaac caccggactt cacagaacat gtcgagaact gggaggtccg ccgtttccgt       960
     gagtcgtata tcaggaagtc gcttgaactt atctttttgg gcaagcagtc tctgcgctta      1020
     gtgcctaagg atgtcgtggt ttcgaatagc aagctacgct cgttccagct ctatcagact      1080
     cacttttcgc acagtttctg gtaccacctg atgggtgaat acgaccataa cgactttaac      1140
     cagcagatgc atccctatga taccaattac cactttgtgc atctttcttc gaattactac      1200
     tacagcgata gggacatcat aaagaactat gaagctcaga tagcgttaga tcccgcgaac      1260
     gctagtatct actacgatga cctgtcattt gtcgcaaatt caaaaggcag caaacagctg      1320
     ctgacataca cctataaaca gaatgttgtt ggccatgagg cattaatgag tgcattgcgc      1380
     ttattccatt tggatcccag ctctactgat ccccgtcagc tctctgacga atttttactg      1440
     gaaagttata aagaagtctg caaggactct ggcccacaga agcacgctga tctccgcaac      1500
     gcgctgagac tcttggcgag atacaaagag agtgacaagc tgaagttcta tgtcgaagtc      1560
     gaaccctttc ccaatgaatt acaggcatac aagctgttgg aaattgacga atcagtcgat      1620
     attgacatta tagaaacagc ttacagcatt aaagtttcag atgcgcctgg gctaaagatg      1680
     gattgtattc gagctttata cactttggca gttgccaaga ggagcatcat acttttcaat      1740
     atcttgtttc agcaatgtcc caagtttcac caattctacc atatgtctta cttgtcctat      1800
     caatctgccc tgcagtattt acatgtaaat gtaaatgcca cagatgattt gattttggaa      1860
     atattccaaa gaaagtggag ttatgatccc cttgtttctc cggagcagct gttgaattta      1920
     aagatcgcgc tcaccaagat tggtttcgaa agaaactcca agctgattaa ccactttctg      1980
     gaaacgggct tggtggatat caactaccta ccagcgggta attggcctac gggcattaac      2040
     aacatcggta acacatgcta cttgaactca ttgctgcaat actactttac aatatcgccc      2100
     ttaagggaat acatcttggc gtatgatcat actgcgtcaa atttactaaa caacgcggtt      2160
     tcatcctctg atatgggcag aagaagaata ggtggaagag ccatttccca agcagaagtg      2220
     gaaagatctg tgcagtttgt ttatcagctg cgttctctct tccatgagat ggttcattct      2280
     agagagagat atgtgacccc tacccgagaa ctcgcctact tgtccttctc tccaagcagt      2340
     accgaggtgg agtttgagcc agtgcctcct gcggttggta cggcctcaaa tgcactcgtt      2400
     gcaaatgaag tatacaatga agatactgag gtgatcgata tctcaatgga ggagtgtgat      2460
     gaagacagcg ccattaatga acttggtgct tctaacatct ccgtcaagtt ggacagcgat      2520
     attggaacgg atagcaatag caatcttgct accggtgcac agacaggcat acccctggac      2580
     gggcacactg atctcaacac tggaataaga acgtgtatgc ctaatgatac tgccataaat      2640
     atggccaccg gtaatgccac cgcgccgaac aaaggaatcg ttaacagtga agctaacttt      2700
     gagcatctca tgacgccagc tccgcacgaa ggaacagaca aacctatcgg aaacgatcag      2760
     tctgttgttc caaaccttgg tacttccaag gataccttaa gcgcttaccc taaaagcggc      2820
     tacgctaaaa ctgctgcttc tgcactttcg acaaataact cagcagcgag cccagatgac      2880
     ttcagtgtca gataccaagc gtcctccgac acagctaata ccggcagtac tcgtccaaat      2940
     ccttccagta cgccagaaag tgggctatcg gattcagccg ccaacgctga atacaccagc      3000
     gcaggtccgc ttgaggatag gcaggctgtt gagaatgatg actcaggtaa agatatcacc      3060
     atggtcggga gtccagaggc cgaaggccct gaaacttcca cctatgttgc gaaaattagt      3120
     tccgaccagc tagaaaacac attggagatt ggcagacagc aagatgtgac ggaatgcatt      3180
     gggaacgtcc tctaccaaat tgagagtgcg tccgtcccgc tcagcttgga tgaagagggc      3240
     gagcaattcg accttgtaaa acagctcttt tatggtaaac tgaaacaaga gctcatcccg      3300
     cttgaatttc ctgaccgcaa gcggacgaag atcgagcgct ttatgtcgct tctggtcaat      3360
     atcggcgatc atccaaaaga tatatatgac gccttggact cctacttcaa agacgaccta      3420
     ctaactctag atgaagacga cggaaaggtc cgccgcagcg ttgccgttgc ggagttgccc      3480
     atcatgctgc agattcagat acagcgagtc tactacgacc gcgagaaatt catgccattc      3540
     aagtccaccg agccgctgcc cttcggcgaa aagctctaca tggatcgcta tctcgctacc      3600
     gataacgctg agctgaacgc caaaaagcag caggccatcg gcctgcgcga ggagctcgaa      3660
     cgcctcaggg aacgccgccg gaggctgctt gccaaaaacg accacggcgt cacgctcagc      3720
     gccgcgctcg cagacacccg ccgcttcctc gatgccgcag aactcacctc cggcagtcgg      3780
     caactccagg agcaatacca cgccacgacc tcccacttgg acgccctccg tgtcgccctc      3840
     gacgaagagc tggccgctct cgatgcccac attgcctcgg tgcaggacgc catcgcccac      3900
     cgtttcgacg ccttctcctc ctatggctac tccctgggcg ccgtgttcat ccacagaggc      3960
     gaggccagct acggccacta ctgggtctat atcaaagact gtcagaatgg cggtatctgg      4020
     cgcaagtaca acgacgagtc tgtcaccgag gtcccggagt ccgaggtttt cgatttttca      4080
     gaagagaata ccgccacccc ttacttcctg gtctacgtca aagaagctca tgagctcgac      4140
     atagagccac taaagcgttt actggcctga                                       4170
//

If you have problems or comments...

PBIL Back to PBIL home page