(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE421

ASHGO_3.PE421        Location/Qualifiers
FT   CDS_pept        complement(729208..729957)
FT                   /codon_start=1
FT                   /gene_family="HOG000112845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622471"
FT                   /locus_tag="AGOS_ACR216C"
FT                   /product="ACR216Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51442.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058470"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI0001DB26FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BQ5"
FT                   /transl_table=1
FT                   /translation="MTSHTVNDIPADFKSTLPPRKRAKTQEEKEQRRIERILRNRKAAH
FT                   QSREKKRLHLLYLERKCALLERIVAHVDLGALVAARGDAALGRAVTEYEAVAREGSGTP
FT                   SFAITLADERSDKDEGAGLSAATTPSVKSPCASGATPGSPCTTVGEEAFGRRDFVLEAK
FT                   PEPLAAESYSYGAFAPAYEEGPRAFGGRPAASESWNLLLTQSQNYPLGGSSIFKDDLNE
FT                   PFELTDSSVDFDHWRNPAAVVQWKRRV"
     atgacaagcc acaccgtgaa cgacatccct gcggacttca agtcgacgct gccgccccgc        60
     aagcgggcca agacgcagga ggagaaggag cagcggcgga tcgagcggat cctgcgcaac       120
     cgcaaggcgg cgcaccagtc gcgcgagaag aagcggctgc acctgctgta cctggagcgc       180
     aagtgcgcgc tgctggagcg gatcgtggcg cacgtggacc tgggcgcgct ggtggcggcg       240
     cgcggggacg cggcgctggg ccgggcggtc acggagtacg aggcggtggc gcgcgagggc       300
     tcgggcacgc cgtcgttcgc gatcacgctg gcggacgagc gcagcgacaa ggacgagggc       360
     gcggggctgt cggcggcgac gacgccgagc gtgaagagcc cctgcgcgtc gggcgcgacg       420
     ccgggctcgc cgtgcacgac ggtgggcgag gaggcgttcg ggcgccggga cttcgtgctg       480
     gaggcgaagc cggagccgct cgcggcggag tcgtactcgt acggcgcgtt cgcgccggcg       540
     tacgaggagg ggccgcgcgc gttcggcggg cggccggccg cgagcgagtc gtggaacctg       600
     ttactaacgc agtcgcagaa ctacccgttg ggcggcagca gtatcttcaa ggacgacctg       660
     aacgagccgt tcgagttgac tgatagctcg gtggactttg accattggcg caatccagca       720
     gcggttgtcc agtggaagag acgagtgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page