(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE434

ASHGO_3.PE434        Location/Qualifiers
FT   CDS_pept        762384..763190
FT                   /codon_start=1
FT                   /gene_family="HOG000246847" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775016"
FT                   /gene_name="HCR1"
FT                   /locus_tag="ACR229W"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit J"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51455.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG392163"
FT                   /db_xref="HOGENOM:HBG398276"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniParc:UPI00002528AD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BP2"
FT                   /transl_table=1
FT                   /translation="MSWDDEEFEVRTSTKDQPMVVSWDDEFNNDDDDALLESWDAEEVP
FT                   KQKQKPKAAPKAAKKVDKKGETVLLEIDTLDEKTRKELLKKAELNSDLNNAAALFDGLG
FT                   VAEEHPRARALRQEEELAALSRPAALTKQTPFESHPLFSEAETKSDFQDLRKALSTAIA
FT                   GMAEKSSLNYSGALAIDLIRDVAKPLSIESIRQTVATLNVLIKEKERQERQARLAKVKG
FT                   GTATGGAGKKKAKAARPNLGGAFKKDQEFSLEDNSEFADFGDDDFM"
     atgtcttggg acgacgagga gtttgaggtg agaacttcga cgaaggacca accgatggtt        60
     gtgtcctggg atgacgagtt caacaacgac gatgacgatg cgctattaga gtcatgggat       120
     gcagaggagg tcccaaagca aaagcaaaag cccaaggcag cacccaaggc agctaagaag       180
     gtcgacaaga agggcgaaac cgtgctgctg gagatcgaca ctctcgatga gaagacgcgc       240
     aaggagcttt tgaagaaggc cgagctcaac tcggacctga acaacgctgc agcgctattt       300
     gatgggcttg gtgttgcaga agaacatccg cgtgcccgcg cgctgcgcca ggaggaggaa       360
     ctagctgcgc tgagccgtcc cgctgcctta acgaagcaga ctcctttcga gagccaccct       420
     ctcttctcag aagcggaaac caagtccgac ttccaggatt tgcggaaggc attgtctact       480
     gcgattgcag gcatggctga gaagtcatca ctaaactatt cgggcgcgct tgccatcgat       540
     ttgatccgtg acgtcgcgaa accattgtcg attgaatcca tcagacaaac ggtcgcgacc       600
     ctgaacgtgc tgatcaaaga aaaggagaga caagaaagac aggcacgtct tgccaaagtt       660
     aagggcggca ctgccaccgg tggtgcaggc aaaaagaagg caaaggctgc aagacctaac       720
     ttgggcggtg cattcaaaaa agaccaggag ttttccttgg aagacaactc tgaatttgca       780
     gactttggcg atgatgactt catgtaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page