(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE435

ASHGO_3.PE435        Location/Qualifiers
FT   CDS_pept        complement(763420..764616)
FT                   /codon_start=1
FT                   /gene_family="HOG000158061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750079"
FT                   /locus_tag="ACR230C"
FT                   /orf_name="AGOS_ACR230C"
FT                   /product="ACR230Cp"
FT                   /biological_process="protein import into peroxisome matrix,
FT                   docking"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="AAS51456.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016560"
FT                   /db_xref="HOGENOM:HBG124210"
FT                   /db_xref="HSSP:1B07"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="UniParc:UPI00002528AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BP1"
FT                   /transl_table=1
FT                   /translation="MSASKPRPKPWETANMSSATSSSGTMDESNTVIPTSVTAASSLGG
FT                   GSGDYGHTPDLPTKPAGLGDESGYKSMNSQFGMNSTPYGGSMYGSGGLYGNSMYGGGGF
FT                   GSMYGGGFGNGYGGYGSMYGGGYGGMYGMGANGMNNNGGIAESTQATFHLIENLIGAVA
FT                   GFAQMLEATYMATHNSFLTMVSVAEQFQYVKEMLGSFFGIFAMIKFLKRVLFKLTGGRM
FT                   GVAPKKQLPPASGDKGKMLQEFDQFRSGKNSAGSTGERKRARIAWKPLFLFFAAVFGFP
FT                   WLLNKFIMKLQEMQNRGRIATPHQPQSLDLNSLEFARAIYDFTPENPRIECALKKGDLM
FT                   AIISRQDPTGKESQWWKVRTKKGDVGYVPCNYIELIRRKKEIELSAGSGTGPSEVVSA"
     atgtcagcca gcaagcctag accaaaacca tgggaaaccg ccaacatgtc atctgctacc        60
     agcagctcgg ggacgatgga tgaaagcaac acagtgatac caacatcagt aactgctgcg       120
     tcttcgttgg gaggcgggag cggcgattac ggacacacgc cggatcttcc gacgaaacct       180
     gcaggccttg gcgatgagtc aggctacaag tcgatgaaca gtcagttcgg aatgaacagt       240
     acgccatacg gagggtcgat gtatgggtcc gggggcctat atggaaactc tatgtacggc       300
     ggaggggggt tcggctcgat gtacggcggc ggatttggga acggttacgg cggatatggt       360
     tcgatgtacg gcggtggcta cggcggaatg tatggtatgg gcgcgaacgg catgaataac       420
     aacggcggta tcgccgagtc gacgcaggct acattccatt tgattgaaaa cttgatcggg       480
     gccgtggccg gctttgcgca gatgctggaa gcgacctaca tggcgacgca taactccttt       540
     ctcacaatgg tatctgtggc agagcagttc caatatgtga aagaaatgct gggttcattt       600
     ttcggtatat ttgccatgat aaagttcttg aaaagggttc ttttcaaatt gaccggtggc       660
     agaatgggcg tcgctccgaa gaagcagttg ccgcctgctt ctggagacaa aggtaagatg       720
     ctacaagaat ttgaccagtt cagatcaggc aaaaacagtg caggttccac cggtgaacgc       780
     aagcgtgcaa gaatagcctg gaagccactt ttcttattct ttgcagctgt tttcggcttc       840
     ccttggttac tcaataaatt tattatgaag ctgcaagaaa tgcagaatag aggacggatt       900
     gctacaccac accaaccaca atcgctagat cttaatagtt tggaattcgc gagggccatt       960
     tacgacttta ccccggagaa tccacgcata gaatgcgccc tgaagaaggg agacttgatg      1020
     gcgatcatat cccggcagga tcccactggc aaagagtctc aatggtggaa agtgaggacg      1080
     aagaagggag atgtaggcta tgtgccatgc aactatatcg aactgataag aagaaaaaag      1140
     gaaatagaat tatcggcggg cagtgggaca ggtccttctg aagtagtctc agcatag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page