(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE44

ASHGO_3.PE44         Location/Qualifiers
FT   CDS_pept        complement(73189..73869)
FT                   /codon_start=1
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747760"
FT                   /locus_tag="ACL162C"
FT                   /orf_name="AGOS_ACL162C"
FT                   /product="ACL162Cp"
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="AAS51066.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG267823"
FT                   /db_xref="HOGENOM:HBG656570"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniParc:UPI000025272C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CT1"
FT                   /transl_table=1
FT                   /translation="MLPFATNQATKRSFSVLATLKTSAAAKAGEGQKFDAMSDPQLAYL
FT                   ERVVRVDQAGELGANYIYAGQFFVLANKHPHLKPVLQHMWDQEIHHHDTFNDLQLRRRV
FT                   RPSLLTPLWKLGAFTMGSVTALLSPEAAMACTEAVETVIGGHYNDQLRCLNSQYEMRRS
FT                   DGTCGQSDELRNLISTIRQFRDDELEHLDTAVQYDSHKAVPYIALTEAIKAICRTAIWT
FT                   AERV"
     atgctcccct ttgctacgaa ccaagctacc aaacgatcat tctctgtgct cgcaacactc        60
     aagacatccg cagccgccaa agcaggcgaa ggccagaagt tcgacgcgat gtccgacccg       120
     cagctggcgt acttagagcg cgttgtgcgg gtagaccagg ctggcgagct gggggccaac       180
     tatatctacg cggggcagtt ctttgtgctc gcaaacaaac acccccatct aaagccagtc       240
     ttgcagcata tgtgggacca ggaaatacac caccatgaca cttttaatga cttgcaactg       300
     aggcgtcgcg tgcggccctc cctactgacg ccgctctgga agctgggtgc gttcaccatg       360
     ggcagtgtca cggcactctt gtcgccggag gcagcaatgg cgtgcaccga ggccgtcgag       420
     accgtgattg gcgggcacta caacgaccag ctgcgctgcc tcaacagcca gtacgagatg       480
     cgcaggtcgg acggcacctg cggccaaagc gacgaactgc gcaacctgat cagcaccatc       540
     cgccaattcc gcgacgatga gctcgagcac ctcgacaccg cggtgcagta cgattcccac       600
     aaggcggtcc cctacatcgc tttgaccgaa gcaataaaag ccatctgccg cacggctatc       660
     tggactgcag agcgcgtgta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page