(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE444

ASHGO_3.PE444        Location/Qualifiers
FT   CDS_pept        complement(779821..781191)
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079262"
FT                   /locus_tag="ACR239C"
FT                   /orf_name="AGOS_ACR239C"
FT                   /product="ACR239Cp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS51465.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="HSSP:1A6Q"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00002528B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BN2"
FT                   /transl_table=1
FT                   /translation="MGQILSNPVIDKEQGRSGDALTAYGMCAMQGWRMSMEDSHIVDLD
FT                   ISPEGSDDHIAYYCVFDGHGGASVAQFCGEQFSRILQQQKDFGGDAPNFARALVAAFIA
FT                   ADEELLKDPVLANDHSGCTATTLLVSHKQQLLVCANSGDSRTVLSTDKNAKALSFDHKP
FT                   TLRSEQSRIMAADGFVEMDRVNGNLALSRAIGDFEFKSNPNLAPHEQIVTCVPDVLEHK
FT                   LDYEKDEFVILACDGIWDCLSSQECVDLIHYGIQQGMGLQDIASRVIDVCCSPTTEGTG
FT                   IGCDNMSFIVVALLRENETEDQWFERMRAKKYQGLLSFEAQRRKVFSYHYDFINEDDDN
FT                   LFDISTKRPEERNRGSGSLPPMHATTREDPDEEDGANPADGRQHLYSLEELINAGGIQI
FT                   TQGGNNTSYIHGSALSEVLASLVGATGGIVARPAQRADAEDNVSEEQDGKKLEEIQE"
     atgggccaga tactgtcgaa cccagttata gacaaggagc aagggcgcag tggggatgcg        60
     ctgacggcct acgggatgtg cgcgatgcag gggtggcgga tgtcgatgga ggactcgcac       120
     atcgtggacc tggacatcag cccggagggc tcggatgacc acatcgcata ctactgcgtg       180
     tttgacgggc acgggggggc gtcggtggct cagttctgcg gggagcaatt ctcgcggata       240
     ctgcagcagc agaaggactt tggcggcgac gcgccgaact ttgcgcgggc actggtggcg       300
     gcgttcatcg cggcggacga ggagttactg aaggacccag tgctggccaa tgaccatagc       360
     ggctgcacag ccaccacgtt gctggtgtca cacaagcagc agctgcttgt gtgcgcgaac       420
     tcgggcgact cgcgcacggt gttgtcaacc gacaagaacg cgaaggcgct ctcgtttgac       480
     cacaagccga cattgcgctc agaacagtcg cggatcatgg cggcagatgg atttgtggaa       540
     atggacaggg tcaatggtaa cttggcgctt tcgcgcgcga ttggggactt tgagttcaag       600
     tcaaacccaa acctggctcc gcacgagcag attgtcacat gtgtaccaga cgtgctagag       660
     cataagctag actacgagaa agacgaattt gtgatcctgg cctgcgacgg gatctgggac       720
     tgtctttcaa gccaggagtg cgtggaccta atccactacg gcattcaaca aggcatgggc       780
     ttgcaggaca tcgcgtcgcg cgtgatagac gtgtgttgct caccaaccac cgaggggacc       840
     ggcattggct gtgacaacat gagtttcatc gttgtcgccc ttctgcggga aaacgagacc       900
     gaggaccagt ggttcgagag aatgcgcgcc aagaaatacc agggtctgct ttcctttgag       960
     gcgcagcgcc gcaaggtctt ctcataccac tacgatttta tcaacgagga cgacgacaac      1020
     ctctttgaca tctcaactaa gcgtccggag gagcgcaacc gtggtagcgg cagccttccc      1080
     ccaatgcacg cgactacgcg cgaggatccc gacgaagagg atggcgccaa ccctgccgac      1140
     ggccgccaac acctctattc gctcgaagag ctcatcaacg ctggcggcat ccagatcaca      1200
     cagggcggca acaatacctc gtacattcac ggctccgcgc tgtcggaagt cttggcttcg      1260
     ctagtcggtg ctacgggtgg catcgttgcg cgccctgcgc agcgcgccga cgctgaggat      1320
     aacgtgagcg aggagcagga cgggaaaaag ctggaggaga tccaggagtg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page