(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE446

ASHGO_3.PE446        Location/Qualifiers
FT   CDS_pept        complement(784351..786738)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19775019"
FT                   /locus_tag="AGOS_ACR241C"
FT                   /product="ACR241Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51467.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124075"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2714"
FT                   /db_xref="UniProtKB/TrEMBL:Q75BN0"
FT                   /transl_table=1
FT                   /translation="MMPLKKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLGNRETCHY
FT                   FISPSEKGGDGGDSPGESAGSNGALERWQFVRAHSCGRVDLTAGRTVVFGKRSAVYVAG
FT                   VLSTDAVRYRDLYLELLSVFSHAAIKKTVSQLHAQAQVGAQEASLPNSVKRVIRMEDEG
FT                   MLQESSPYILAKHKKVHQSLVDGFAQSRYEGRQQFADVEEAAKQHLVERYIFLQKVLPA
FT                   FKKHVLPLIPIYDERMLCVTVEQLYDDYQKRGKFSAKNGDLITVATILLITRLVYLAIR
FT                   FDKCSVVNVKYNRILELDTEPYAALAYELLPRDKLLRKVTLPQLQCLILLRFHNWCSPM
FT                   DGDGESLQYSNVLMGTIYACCKEIGASWLSFKEPDKYDFAKARGSNSRFTMAFAEMEPG
FT                   EVDSANESVVKLYQQIWAVVLHWDRNVSMLTGLEPIIGTSMKPAAMSSYNNWYADMISL
FT                   DYLKWQLLTRINEDPSEVNLEEVKPIISEIRQRLGQFTSESELAFEQELILQLVELSIL
FT                   HAAFIGPTSNVSAAEHRKNYQELLERIIHLSGIFITYFHDPPTTNHQYGRFYTNKIVEV
FT                   AMYRVYQILTGLILRISSACQDQSLKPTLMKFYKNLCSLYFNELGYDYYQVFKRLFEAK
FT                   VKYKILEQTANPVFIMLRYLFAEIQSGNMESMKSQELIGLIYGEYKKMGGELNLDMMDL
FT                   WNHIVPTQCDHNIGLNSLFTTEIFPTDQYSDYNLFVSFYDYASNKLTEDTNQAAEKSIA
FT                   HNPSTSIHDLCKGGASPHFDLLEGILDPLDFMTYLDSIPGET"
     atgatgccat taaagaaacg gcagcggcag acgcttgtct gttcgaactg caagcgccgg        60
     aagtctcgat gcgacagagg gaagcctgca tgcggaaatt gcatacgatt gggcaaccgg       120
     gagacttgcc actactttat ttcgccctct gagaaaggcg gcgacggcgg ggactcgccg       180
     ggagagtctg cgggcagtaa tggggcgctg gagcggtggc agttcgtgcg cgcgcacagc       240
     tgcgggcggg tggacttgac tgccgggcgc acggtggtgt ttggcaagcg cagcgcggta       300
     tacgttgcgg gggtgctgag cacggacgcc gtacgatacc gcgacctgta cttggagcta       360
     ctgagtgtgt tttcgcacgc ggccatcaag aagacggtga gtcagctgca tgcacaggcg       420
     caggtaggcg cgcaggaggc ttcgctaccc aactcggtga aacgtgtgat tcggatggag       480
     gacgagggga tgctgcagga gtcgtcgccg tacatcctgg cgaagcacaa gaaggtgcac       540
     cagtcgctgg tggatgggtt tgcgcagagc cggtacgagg gtcggcagca gtttgcggat       600
     gtggaagagg cagcgaagca gcacctggtg gaaaggtaca tattcctgca gaaggtgtta       660
     ccggcgttta agaagcatgt gctgccgctg ataccgatat atgacgagcg gatgttgtgc       720
     gtgacggtgg agcagctata cgatgactat caaaagcgcg gcaagttctc tgccaagaac       780
     ggcgatctta tcacggtcgc gacaatcttg ctgatcacgc gcctagtgta cctcgcgatc       840
     cggtttgaca aatgctcggt ggtgaatgtc aagtataaca gaattttgga gcttgacacg       900
     gagccgtatg ctgcactcgc atacgaacta cttccccggg ataaactgct ccggaaggtg       960
     acactgccgc agctccaatg tctcatattg ctgcggttcc ataattggtg ttccccgatg      1020
     gacggcgacg gagagtcgtt gcaatatagc aatgtcctaa tgggtacgat ttatgcctgt      1080
     tgcaaggaga ttggcgcgag ctggctcagc ttcaaggagc ccgacaagta tgattttgcc      1140
     aaggctcgtg gtagtaactc tcgcttcacc atggcctttg cggaaatgga acccggagaa      1200
     gtcgactccg cgaatgaaag tgttgtgaag ctttaccagc agatctgggc ggttgttttg      1260
     cactgggacc ggaacgtaag catgctcacc ggtctggagc cgataattgg cacttcaatg      1320
     aaaccggcgg ctatgtcctc ttacaataac tggtacgcgg acatgatatc attggactat      1380
     ctaaaatggc aattgcttac gcgaataaat gaagacccat cagaggtgaa cttggaagaa      1440
     gtgaagccga tcatcagcga aatacggcag cgtttggggc aattcacctc cgagtctgaa      1500
     ctagcttttg aacaggagtt gatcctccag cttgttgaac tctctatcct acacgcggct      1560
     ttcatcgggc ctacatccaa tgtatccgct gccgagcaca gaaagaatta ccaggagtta      1620
     ttggagagga tcattcacct atctggaatc tttatcacgt attttcatga cccgccgacg      1680
     accaaccacc aatacggccg cttttacacg aataagatcg tagaagtggc gatgtacagg      1740
     gtataccaaa tactaacggg cctaatattg cgcatatcaa gtgcttgcca ggaccaatcg      1800
     cttaagccaa cacttatgaa gttttacaaa aatctatgct cactatactt taatgaacta      1860
     ggctacgatt actaccaggt attcaaaaga ttatttgagg caaaggtcaa gtacaagata      1920
     ctggagcaga ctgcaaaccc agtattcata atgctacgct acttatttgc tgagattcag      1980
     agcggcaata tggaaagtat gaagagccaa gagttaatcg ggttgattta tggggaatat      2040
     aagaaaatgg gaggggaact aaatcttgac atgatggacc tctggaacca catagttccc      2100
     acacaatgtg accacaatat tggtctcaac agcttattca cgactgagat ctttccaaca      2160
     gaccagtata gtgattataa tcttttcgtt tcattttacg actatgcctc caataagctc      2220
     accgaggata caaaccaagc agcggaaaaa tcgattgcgc ataatccatc tacttccata      2280
     cacgatttgt gtaaaggtgg agcatcgcca cattttgact tactagaagg catacttgac      2340
     cctcttgact ttatgacata cctggatagt attcccggtg aaacctaa                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page