(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE7

ASHGO_3.PE7          Location/Qualifiers
FT   CDS_pept        complement(13961..15061)
FT                   /codon_start=1
FT                   /gene_family="HOG000159494" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778690"
FT                   /gene_name="QCR2"
FT                   /locus_tag="ACL199C"
FT                   /product="Cytochrome b-c1 complex subunit 2, mitochondrial "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="proteolysis"
FT                   /biological_process="transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS51029.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG058522"
FT                   /db_xref="HOGENOM:HBG737788"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI0001DB26F4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CW5"
FT                   /transl_table=1
FT                   /translation="MLSQRLQCSKQFARHLSVAAKDGSGKVSTLSVQVQGGSRYATKDG
FT                   VAHLLSRFNFHNTGNKSALRLVRESELLGGRFQSTVDREHITLSATFLKEDLPYFVNAL
FT                   ADVLYKTSFRPHELAESVLPAATRDAAVARACPVAAAEEALYSVTYRHGLGKPVLYDGV
FT                   EKVTLEDIKAYADKVYTKENVTVLGQGINEADLKRFVNDSLLASLPSGTSLAGSGNAKT
FT                   HSGEARLRHAGSSVAAIAVPVAKADFATYEVLARYLTSDLYALSPLVHKAKLDKYTDGG
FT                   LFSLYVKSAEAAKAAADIKKVVADLKAGKDISVARKYAALQLAVENDSAASPVSLKLEN
FT                   AKDFKLGKFNYVAVGDVSNLPFADEL"
     atgttgtccc agagattgca gtgcagcaag cagttcgcca gacacctgag cgtggcagcc        60
     aaggacggct ccggcaaggt gtcgaccctg agcgtgcagg tgcagggcgg gtcgcggtac       120
     gcgacgaagg acggcgtggc gcacctgctg tcgcggttca acttccacaa cacgggcaac       180
     aagtctgcgt tgcgtctggt gcgcgagtcg gagctgttgg gcggcagatt ccagtcgacg       240
     gtggaccgcg agcacatcac gctgtctgcg acgttcctca aggaggactt gccgtacttt       300
     gtcaacgcgc tggccgacgt gctgtacaag acgtcgttcc ggccgcacga gctggcggag       360
     tcggtgcttc ctgcggcgac gcgcgacgcg gcggtggcgc gcgcgtgccc tgtggcggcc       420
     gcggaagagg ctctgtacag cgtgacgtac agacacgggc tgggcaagcc ggtgctgtac       480
     gacggggtgg agaaggtcac gctggaggac atcaaggcgt acgcggacaa ggtgtacacc       540
     aaggagaacg tgacggttct gggccagggc atcaacgagg cggacctgaa gcggtttgtc       600
     aacgactcgc tgcttgcgtc gctgccatcg ggcacctcgc tggccggctc cggcaacgcg       660
     aagacgcact ccggggaggc gcggttgaga cacgcgggct cctccgtggc tgcgattgcc       720
     gttccggtgg ccaaggccga ctttgccacc tacgaggtcc tggccagata cttgacttcg       780
     gacctgtacg cgctttctcc gctggtgcat aaggcgaagt tggacaagta caccgacggc       840
     ggcctgttct cgctctacgt caagtccgcg gaggccgcca aggctgctgc ggacatcaag       900
     aaggttgtcg ccgacttgaa ggccggcaaa gacatctccg tggcccgcaa gtacgccgct       960
     ctgcagttgg ctgtcgaaaa cgactccgcc gcctcccctg ttagcttgaa gctcgagaac      1020
     gctaaggact tcaagttggg taaattcaac tacgttgccg tcggggatgt gagcaacttg      1080
     ccatttgctg atgaactgta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page